Home » MYL6 » MYL6 Antibodies » MYL6 Antibody

MYL6 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: MYL6 Antibody [NBP1-54376] - Human 721_B, Antibody Dilution: 1.0 ug/ml MYL6 is supported by BioGPS gene expression data to be expressed in 721_B.
Western Blot: MYL6 Antibody [NBP1-54376] - Human 721_B, Antibody Dilution: 1.0 ug/ml MYL6 is supported by BioGPS gene expression data to be expressed in 721_B.
Immunohistochemistry: MYL6 Antibody [NBP1-54376] - Staining of human Prostate.
Western Blot: MYL6 Antibody [NBP1-54376] - HepG2 tissue lysate at a concentration of 1ug/ml.
Immunohistochemistry: MYL6 Antibody [NBP1-54376] - Human Skeletal Muscle.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

MYL6 Antibody Summary

Immunogen
Synthetic peptides corresponding to MYL6(myosin, light chain 6, alkali, smooth muscle and non-muscle) The peptide sequence was selected from the N terminal of MYL6. Peptide sequence CDFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKV. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MYL6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against MYL6 and was validated on Western blot.
Theoretical MW
17 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MYL6 Antibody

  • ESMLC
  • LC17
  • LC17A
  • LC17B
  • LC17-GI
  • LC17-NM
  • MLC1SM
  • MLC-3
  • MLC3NM
  • MLC3SM
  • Myosin light chain 3
  • Myosin light chain A3
  • Myosin light chain alkali 3
  • myosin light polypeptide 6,17 kDa myosin light chain
  • myosin, light chain 6, alkali, smooth muscle and non-muscle
  • myosin, light polypeptide 6, alkali, smooth muscle and non-muscle
  • Smooth muscle and nonmuscle myosin light chain alkali 6

Background

MYL6 contains 3 EF-hand domains. It is the regulatory light chain of myosin. MYL6 does not bind calcium. Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain that is expressed in smooth muscle and non-muscle tissues. Genomic sequences representing several pseudogenes have been described and two transcript variants encoding different isoforms have been identified for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Myosin Heavy Chain
Antibody (MF20) [Unco ...
MAB4470
Myosin Heavy Chain was detected in immersion fixed paraffin-embedded sections of human skeletal muscle using Mouse Anti-Myosin Heavy Chain Monoclonal Antibody (Catalog # MAB4470) at 5 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Mouse IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC001). Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to sarcoplasm. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
Myosin Heavy Chain was detected in perfusion fixed frozen sections of mouse skeletal muscle using Mouse Anti-Myosin Heavy Chain Monoclonal Antibody (Catalog # MAB4470) at 5 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Mouse IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC001). Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to sarcoplasm. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
Myosin Heavy Chain was detected in immersion fixed C2C12 mouse myoblast cell line using Mouse Anti-Human Myosin Heavy Chain Monoclonal Antibody (Catalog # MAB4470) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counter­stained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(1 Review)
(81 Publications)
Species: All-Multi
Applications: ICC, IHC, WB
MRLC2 Antibody
NBP2-54719
Immunocytochemistry/Immunofluorescence: MRLC2 Antibody [NBP2-54719] - MRCL3 Antibody [NBP2-54719] - Staining of human cell line U-2 OS shows localization to nucleus & nucleoli fibrillar center.
Immunohistochemistry-Paraffin: MRCL3 Antibody [NBP2-54719] - Staining of human smooth muscle shows moderate cytoplasmic positivity in smooth muscle cells.
Western Blot: MRCL3 Antibody [NBP2-54719] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251 MG Lane 4: Human plasma Lane 5: Human Liver tissue Lane 6: Human Tonsil tissue
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Vimentin Antibody
NB300-223
Immunocytochemistry/Immunofluorescence: Vimentin Antibody [NB300-223] - Analysis of HeLa cell culture. Antibody at 1:10,000 in green, and costained with mouse mAb to actin, dilution 1:500 in red. The blue is DAPI staining of nuclear DNA. The vimentin antibody stains the intermediate filament network while the actin antibody labels the submembranous cytoskeleton, stress fibers, and bundles of actin associated with cell adhesion sites.
Immunohistochemistry-Frozen: Vimentin Antibody [NB300-223] - 10 um Cryosections from PFA fixed murine brain acute slices stained with Vimentin antibody (1:600) and Alexa Fluor 488 anti chicken IgG. Antibody showed specific staining, also of blood vessels. IHC-Fr image submitted by a verified customer review.
Immunocytochemistry/Immunofluorescence: Vimentin Antibody [NB300-223] - Human A7 cells. Cells were fixed with 10% formalin and permeabilized with 0.1% TritonX-100. After blocking, cells were incubated with primary antibody (1:600) at 4C O/N followed with Alexa Fluor 488 labeled secondary antibody and counterstained with DAPI and Phalloidin for nuclei and F-actin respectively. Imaged with Leica TCS SP5 confocal microscope. ICC/IF image submitted by a verified customer review.
(6 Reviews)
(55 Publications)
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
MLC1 Antibody
NBP1-81555
Western Blot: MLC1 Antibody [NBP1-81555] - Analysis in control (vector only transfected HEK293T lysate) and MLC1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: MLC1 Antibody [NBP1-81555] - Staining of human cerebellum shows moderate cytoplasmic positivity in neuropil of the molecular layer.
Immunohistochemistry-Paraffin: MLC1 Antibody [NBP1-81555] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuropil.
(2 Publications)
Species: Hu
Applications: IHC, IHC-P, WB
MYL9 Antibody
NBP2-94899
Immunohistochemistry: MYL9 Antibody [NBP2-94899] - Analysis of Human colon carcinoma using MYL9 at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunohistochemistry: MYL9 Antibody [NBP2-94899] - Analysis of Mouse intestine using MYL9 at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunohistochemistry: MYL9 Antibody [NBP2-94899] - Analysis of Rat intestine using MYL9 at dilution of 1:100. Blue: DAPI for nuclear staining.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
MHC Class I
Antibody (OX18) - BSA
NB120-6405
Flow Cytometry: MHC Class I Antibody (OX18) [NB120-6405] - Analysis using the FITC conjugate of NB120-6405. Staining of rat spleen cells with mouse anti-rat RT1-A (OX18).
Immunocytochemistry/Immunofluorescence: MHC Class I Antibody (OX18) [NB120-6405] - PC12 cells were fixed for 10 minutes using 4% PFA and then permeabilized for 5 minutes using 1X PBS + 0.05% Triton-X100. The cells were incubated with anti-MHC Class I Antibody (OX18) at 2 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunocytochemistry/Immunofluorescence: MHC Class I Antibody (OX18) [NB120-6405] - Major histocompatibility complex (MHC) I and II as well as Transporter associated with antigen presentation II (TAPII) were analyzed, using immunocytochemistry on rat Schwann cells (SCs). Corresponding merges are shown in the bottom rows. Treatment of SCs with IL-17 was performed at concentrations of 0.5 and 50 ng/mL. Graphs to the right show densitometry quantification. SCs showed expression of MHCI > TAPII > MHCII, which increased after IL-17 treatment. MHCI was mainly detected in the cytoplasm and the expression increased in a dose-dependent manner after IL-17 treatment, significant for 0.5 ng/mL and 50 ng/mL (**P <=0.01). Image collected and cropped by CiteAb from the following publication (http://jneuroinflammation.biomedcentral.com/articles/10.1186/1742-2094-11-63), licensed under a CC-BY licence.
(33 Publications)
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Myosin light chain
kinase Antibody
NBP1-87744
Immunohistochemistry-Paraffin: Myosin light chain kinase Antibody [NBP1-87744] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: Myosin light chain kinase Antibody [NBP1-87744] - Staining of human smooth muscle shows high expression.
Immunohistochemistry-Paraffin: Myosin light chain kinase Antibody [NBP1-87744] - Staining in human smooth muscle and skeletal muscle tissues using anti-MYLK antibody. Corresponding MYLK RNA-seq data are presented for the same tissues.
Species: Hu
Applications: IHC, IHC-P, WB
GLI-1 Antibody -
BSA Free
NB600-600
Immunohistochemistry-Paraffin: GLI-1 Antibody [NB600-600] - Staining in canine hair follicle. Image from a verified customer review.
Knockdown Validated: GLI-1 Antibody - BSA Free [NB600-600] - GLI-1 Antibody [NB600-600] - Inhibition of Hh signaling in CAFs blocks its effects on lymphangiogenesis in vivo and in vitro. (E) IHC staining for Ki-67, -SMA, Gli-1 and LYVE1 in tumour sections from mice in the two groups. Human CAFs promote lymphangiogenesis in ovarian cancer via the Hh-VEGF-C signaling axis. Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31012844/) licensed under a CC-BY licence.
Flow (Intracellular): GLI-1 Antibody [NB600-600] - Staining for GLI-1 in untreated human B cell lines (BCWM.1, MWCL-1 and RPCI-WM1) using anti-GLI-1 antibody. Rabbit IgG Isotype Control (Cat# NBP2-36463) was used as a negative control. Image courtesy of Sherine Elsawa, Northern Illinois University.
(1 Review)
(43 Publications)
Species: Ca, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, KD, WB
MRCL3 [p Ser19, p
Ser20] Antibody
NB100-1687
Western Blot: MRCL3 [p Ser19, p Ser20] Antibody [NB100-1687] - This antibody has been shown to cross-react with mouse skeletal muscle regulatory light chain (Lai et al., 2016. Am J Physiol Endocrinol Metab), and is shown to positively react with mouse EDL muscle here. This image was submitted via customer Review.
Western Blot: MRCL3 [p Ser19, p Ser20] Antibody [NB100-1687] - Affinity purified phosphospecific antibody to monophosphorylated regulatory light chain of smooth and non-muscle Myosin at pS19 was used at a 1:1000 dilution to detect myosin light chain by Western blot. Approximately 12 ul of a mouse cardiac myocyte lysate was loaded on a 4-20% Criterion gel for SDS-PAGE. Samples were either mock treated or insulin or CLA treated according as indicated. After washing, a 1:5,000 dilution of HRP conjugated Gta- Rabbit IgG (611-103-122) preceded color development using Amersham's substrate system. Other detection methods will yield similar results.
Immunohistochemistry: MRCL3 [p Ser19, p Ser20] Antibody [NB100-1687] - Used at 2.5 ug/ml to detect signal in a variety of tissues including multi-human, multi-brain and multi-cancer slides. This image shows strong staining of both vascular and myometrial smooth muscle cells of the uterus. Tissue was formalin-fixed and paraffin embedded. The image shows localization of the antibody as the precipitated red signal, with a hematoxylin purple nuclear counterstain.
(1 Review)
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, IP, WB
IGFBP-3 [HRP]
DGB300
(42 Publications)
Species: Hu
Applications: ELISA
TPD52 Antibody
NBP2-38952
Immunohistochemistry-Paraffin: TPD52 Antibody [NBP2-38952] - Staining of human prostate shows high expression.
Immunohistochemistry-Paraffin: TPD52 Antibody [NBP2-38952] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: TPD52 Antibody [NBP2-38952] - Staining in human prostate and skeletal muscle tissues using anti-TPD52 antibody. Corresponding TPD52 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Integrin alpha 9
Antibody [Unconjugate ...
AF3827
Integrin  alpha 9 was detected in perfusion fixed frozen sections of mouse liver tissue using Goat Anti-Mouse Integrin  alpha 9 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3827) at 1 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Goat IgG VisUCyte™ HRP Polymer Antibody (brown; Catalog # VC004) and counterstained with hematoxylin (blue). Specific staining was localized to bile canaliculi. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
(20 Publications)
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
Ezrin Antibody -
BSA Free
NBP2-52977
Immunocytochemistry/Immunofluorescence: Ezrin Antibody [NBP2-52977] - HeLa cells were fixed in 4% paraformaldehyde for 10 minutes and permeabilized in 0.05% Triton X-100 in PBS for 5 minutes. The cells were incubated with anti- conjugated to Alexa Fluor 647 (NBP2-52977AF647) at 5 ug/ml for 1 hour at room temperature. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunocytochemistry/Immunofluorescence: Ezrin Antibody [NBP2-52977] - HeLa cells were fixed in 4% paraformaldehyde for 10 minutes and permeabilized in 0.05% Triton X-100 in PBS for 5 minutes. The cells were incubated with Ezrin Antibody (NBP2-52977) at 1 ug/ml overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:1000 dilution for 60 minutes. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 100X objective and digitally deconvolved.
Immunocytochemistry/Immunofluorescence: Ezrin Antibody [NBP2-52977] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton-X100. The cells were incubated with anti-EZR at a 1:200 dilution overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:500 dilution. Alpha tubulin (DM1A) NB100-690 was used as a co-stain at a 1:1000 dilution and detected with an anti-mouse Dylight 550 (Red) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Fast skeletal
myosin light chain 1 ...
NBP2-16433
Western Blot: Fast skeletal myosin light chain 1 Antibody [NBP2-16433] - Rat tissue extracts (1 ug) was separated by 15 % SDS-PAGE, and the membrane was blotted with Fast skeletal myosin light chain 1 antibody at a dilution of 1:20000.
Western Blot: Fast skeletal myosin light chain 1 Antibody [NBP2-16433] - RD whole cell extract (30 ug) was separated by 15% SDS-PAGE, and the membrane was blotted with Fast skeletal myosin light chain 1 antibody diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Western Blot: Fast skeletal myosin light chain 1 Antibody [NBP2-16433] - Sample (whole cell lysate) A: 1ug mouse heart, B: 5ug mouse heart, 15% SDS PAGE gel, diluted at 1:10000.
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Myosin Light Chain
2 Antibody
NBP1-85541
Immunohistochemistry-Paraffin: Myosin Light Chain 2 Antibody [NBP1-85541] - Analysis in human heart muscle and pancreas tissues. Corresponding Myosin Light Chain 2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Myosin Light Chain 2 Antibody [NBP1-85541] - Staining of human heart muscle shows moderate to strong cytoplasmic positivity in cardiomyocytes.
Immunohistochemistry-Paraffin: Myosin Light Chain 2 Antibody [NBP1-85541] - Staining of human liver shows no positivity in hepatocytes as expected.
(1 Review)
(2 Publications)
Species: Hu, Mu
Applications: IHC, IHC-Fr, IHC-P, WB
Myosin light chain
3 Antibody
NBP1-88068
Immunohistochemistry-Paraffin: Myosin light chain 3 Antibody [NBP1-88068] - Analysis in human heart muscle and lymph node tissues. Corresponding MYL3 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Myosin light chain 3 Antibody [NBP1-88068] - Staining of human heart muscle shows moderate to strong cytoplasmic positivity in cardiomyocytes.
Immunohistochemistry-Paraffin: Myosin light chain 3 Antibody [NBP1-88068] - Staining of human cerebral cortex shows no positivity in neurons as expected.
Species: Hu
Applications: IHC, IHC-P
RNF23 Antibody
NBP2-20183
Immunohistochemistry-Paraffin: RNF23 Antibody [NBP2-20183] - RNF23 antibody detects TRIM39 protein at cytosol on human colon carcinoma by immunohistochemical analysis. Sample: Paraffin-embedded colon carcinoma.RNF23 antibody dilution: 1:500.
Western Blot: RNF23 Antibody [NBP2-20183] - Sample (30 ug of whole cell lysate) A: A431 7. 5% SDS PAGE gel, diluted at 1:1000.
Western Blot: RNF23 Antibody [NBP2-20183] - Sample (50 ug of whole cell lysate) A: Mouse Testis, 7. 5% SDS PAGE gel, diluted at 1:1000.
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
MYL6 Antibody
NBP1-54376
MYL6 Antibody
Species: Hu
Applications: WB, IHC, IHC-P

Publications for MYL6 Antibody (NBP1-54376) (0)

There are no publications for MYL6 Antibody (NBP1-54376).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MYL6 Antibody (NBP1-54376) (0)

There are no reviews for MYL6 Antibody (NBP1-54376). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MYL6 Antibody (NBP1-54376) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MYL6 Products

Bioinformatics Tool for MYL6 Antibody (NBP1-54376)

Discover related pathways, diseases and genes to MYL6 Antibody (NBP1-54376). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MYL6 Antibody (NBP1-54376)

Discover more about diseases related to MYL6 Antibody (NBP1-54376).
 

Pathways for MYL6 Antibody (NBP1-54376)

View related products by pathway.

PTMs for MYL6 Antibody (NBP1-54376)

Learn more about PTMs related to MYL6 Antibody (NBP1-54376).
 

Research Areas for MYL6 Antibody (NBP1-54376)

Find related products by research area.

Blogs on MYL6

There are no specific blogs for MYL6, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MYL6 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol MYL6
Uniprot