MYL6 Antibody - BSA Free

Western Blot: MYL6 Antibody [NBP1-54376] - Human 721_B, Antibody Dilution: 1.0 ug/ml MYL6 is supported by BioGPS gene expression data to be expressed in 721_B.

Immunohistochemistry: MYL6 Antibody [NBP1-54376] - Staining of human Prostate.

Western Blot: MYL6 Antibody [NBP1-54376] - HepG2 tissue lysate at a concentration of 1ug/ml.

Immunohistochemistry: MYL6 Antibody [NBP1-54376] - Human Skeletal Muscle.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

MYL6 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to MYL6(myosin, light chain 6, alkali, smooth muscle and non-muscle) The peptide sequence was selected from the N terminal of MYL6. Peptide sequence CDFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKV. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MYL6
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml
• Theoretical MW: 17 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for MYL6 Antibody - BSA Free

• ESMLC
• LC17
• LC17A
• LC17B
• LC17-GI
• LC17-NM
• MLC1SM
• MLC-3
• MLC3NM
• MLC3SM
• Myosin light chain 3
• Myosin light chain A3
• Myosin light chain alkali 3
• myosin light polypeptide 6,17 kDa myosin light chain
• myosin, light chain 6, alkali, smooth muscle and non-muscle
• myosin, light polypeptide 6, alkali, smooth muscle and non-muscle
• Smooth muscle and nonmuscle myosin light chain alkali 6

Background

MYL6 contains 3 EF-hand domains. It is the regulatory light chain of myosin. MYL6 does not bind calcium. Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain that is expressed in smooth muscle and non-muscle tissues. Genomic sequences representing several pseudogenes have been described and two transcript variants encoding different isoforms have been identified for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MYL6
• Uniprot:
  • P60660(Human)