MYL6 Antibody

Images

 
Western Blot: MYL6 Antibody [NBP1-54376] - Human 721_B, Antibody Dilution: 1.0 ug/ml MYL6 is supported by BioGPS gene expression data to be expressed in 721_B.
Immunohistochemistry: MYL6 Antibody [NBP1-54376] - Staining of human Prostate.
Western Blot: MYL6 Antibody [NBP1-54376] - HepG2 tissue lysate at a concentration of 1ug/ml.
Immunohistochemistry: MYL6 Antibody [NBP1-54376] - Human Skeletal Muscle.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MYL6 Antibody Summary

Immunogen
Synthetic peptides corresponding to MYL6(myosin, light chain 6, alkali, smooth muscle and non-muscle) The peptide sequence was selected from the N terminal of MYL6. Peptide sequence CDFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKV. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MYL6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against MYL6 and was validated on Western blot.
Theoretical MW
17 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MYL6 Antibody

  • ESMLC
  • LC17
  • LC17A
  • LC17B
  • LC17-GI
  • LC17-NM
  • MLC1SM
  • MLC-3
  • MLC3NM
  • MLC3SM
  • Myosin light chain 3
  • Myosin light chain A3
  • Myosin light chain alkali 3
  • myosin light polypeptide 6,17 kDa myosin light chain
  • myosin, light chain 6, alkali, smooth muscle and non-muscle
  • myosin, light polypeptide 6, alkali, smooth muscle and non-muscle
  • Smooth muscle and nonmuscle myosin light chain alkali 6

Background

MYL6 contains 3 EF-hand domains. It is the regulatory light chain of myosin. MYL6 does not bind calcium. Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain that is expressed in smooth muscle and non-muscle tissues. Genomic sequences representing several pseudogenes have been described and two transcript variants encoding different isoforms have been identified for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB4470
Species: All-Multi
Applications: ICC, IHC, WB
NBP2-54719
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB300-223
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-81555
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-94899
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NB120-6405
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-87744
Species: Hu
Applications: IHC, IHC-P, WB
NB600-600
Species: Ca, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, KD, WB
NB100-1687
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, IP, WB
DGB300
Species: Hu
Applications: ELISA
NBP2-38952
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF3827
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
NBP2-52977
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-16433
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP1-85541
Species: Hu, Mu
Applications: IHC, IHC-Fr, IHC-P, WB
NBP1-88068
Species: Hu
Applications: IHC, IHC-P
NBP2-20183
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-54376
Species: Hu
Applications: WB, IHC, IHC-P

Publications for MYL6 Antibody (NBP1-54376) (0)

There are no publications for MYL6 Antibody (NBP1-54376).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MYL6 Antibody (NBP1-54376) (0)

There are no reviews for MYL6 Antibody (NBP1-54376). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MYL6 Antibody (NBP1-54376) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MYL6 Products

Bioinformatics Tool for MYL6 Antibody (NBP1-54376)

Discover related pathways, diseases and genes to MYL6 Antibody (NBP1-54376). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MYL6 Antibody (NBP1-54376)

Discover more about diseases related to MYL6 Antibody (NBP1-54376).
 

Pathways for MYL6 Antibody (NBP1-54376)

View related products by pathway.

PTMs for MYL6 Antibody (NBP1-54376)

Learn more about PTMs related to MYL6 Antibody (NBP1-54376).
 

Research Areas for MYL6 Antibody (NBP1-54376)

Find related products by research area.

Blogs on MYL6

There are no specific blogs for MYL6, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MYL6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MYL6
Uniprot