Myosin light chain 3 Antibody


Western Blot: Myosin light chain 3 Antibody [NBP1-88068] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA more
Immunocytochemistry/ Immunofluorescence: Myosin light chain 3 Antibody [NBP1-88068] - Staining of human cell line A-431 shows positivity in nucleoli and mitochondria.
Immunohistochemistry-Paraffin: Myosin light chain 3 Antibody [NBP1-88068] - Staining of human skeletal muscle shows high expression.
Immunohistochemistry-Paraffin: Myosin light chain 3 Antibody [NBP1-88068] - Staining of human prostate shows low expression as expected.
Immunohistochemistry-Paraffin: Myosin light chain 3 Antibody [NBP1-88068] - Staining in human skeletal muscle and prostate tissues using anti-MYL3 antibody. Corresponding MYL3 RNA-seq data are presented for the same more

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

Myosin light chain 3 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: KPEPKKDDAKAAPKAAPAPAPPPEPERPKEVEFDASKIKIEFTPEQIEEFKEAFMLFDRTPKCEM
Specificity of human Myosin light chain 3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Myosin light chain 3 Protein (NBP1-88068PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (81%), Rat (86%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Myosin light chain 3 Antibody

  • Cardiac myosin light chain 1
  • CMH8Ventricular/slow twitch myosin alkali light chain
  • CMLC1
  • light polypeptide 3, alkali; ventricular, skeletal, slow
  • MLC1SBMyosin light chain 1, slow-twitch muscle B/ventricular isoform
  • MLC1V
  • myosin light chain 3
  • myosin, light chain 3, alkali; ventricular, skeletal, slow
  • VLC1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Hu, Mu, Rt, Xp
Applications: WB, ELISA, Flow, ICC/IF
Species: Hu, Mu, Rt, Po, Bv, Ca, Fe, Fi, Gt, Rb
Applications: WB, ChIP, Flow, IA, ICC/IF, IHC, IHC-P, IP, S-ELISA
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt, Po
Applications: WB, IHC, IHC-P
Species: Hu, Rt
Applications: WB, IHC, IHC-P
Species: Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu, Rt, Av, Ch, Fi, Ma, Re
Applications: WB, EM, ICC/IF, IHC, IHC-Fr
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Myosin light chain 3 Antibody (NBP1-88068) (0)

There are no publications for Myosin light chain 3 Antibody (NBP1-88068).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Myosin light chain 3 Antibody (NBP1-88068) (0)

There are no reviews for Myosin light chain 3 Antibody (NBP1-88068). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Myosin light chain 3 Antibody (NBP1-88068) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Myosin light chain 3 Products

Bioinformatics Tool for Myosin light chain 3 Antibody (NBP1-88068)

Discover related pathways, diseases and genes to Myosin light chain 3 Antibody (NBP1-88068). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Myosin light chain 3 Antibody (NBP1-88068)

Discover more about diseases related to Myosin light chain 3 Antibody (NBP1-88068).

Pathways for Myosin light chain 3 Antibody (NBP1-88068)

View related products by pathway.

Blogs on Myosin light chain 3

There are no specific blogs for Myosin light chain 3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Myosin light chain 3 Antibody and receive a gift card or discount.


Gene Symbol MYL3