Myosin light chain 3 Antibody

Images

 
Immunohistochemistry-Paraffin: Myosin light chain 3 Antibody [NBP1-88068] - Staining of human skeletal muscle shows moderate to strong cytoplasmic positivity in myocytes.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Myosin light chain 3 Antibody [NBP1-88068] - Analysis in human heart muscle and lymph node tissues. Corresponding MYL3 RNA-seq data are presented for the same ...read more
Immunohistochemistry-Paraffin: Myosin light chain 3 Antibody [NBP1-88068] - Staining of human heart muscle shows moderate to strong cytoplasmic positivity in cardiomyocytes.
Immunohistochemistry-Paraffin: Myosin light chain 3 Antibody [NBP1-88068] - Staining of human cerebral cortex shows no positivity in neurons as expected.
Immunohistochemistry-Paraffin: Myosin light chain 3 Antibody [NBP1-88068] - Staining of human lymph node shows no positivity in non-germinal center cells as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Myosin light chain 3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KPEPKKDDAKAAPKAAPAPAPPPEPERPKEVEFDASKIKIEFTPEQIEEFKEAFMLFDRTPKCEM
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MYL3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Myosin light chain 3 Recombinant Protein Antigen (NBP1-88068PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%), Rat (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Myosin light chain 3 Antibody

  • Cardiac myosin light chain 1
  • CMH8Ventricular/slow twitch myosin alkali light chain
  • CMLC1
  • light polypeptide 3, alkali; ventricular, skeletal, slow
  • MLC1SBMyosin light chain 1, slow-twitch muscle B/ventricular isoform
  • MLC1V
  • myosin light chain 3
  • myosin, light chain 3, alkali; ventricular, skeletal, slow
  • VLC1

Background

Myosin light chain 3, or MYL3 for short, consists of a 195 amino acid isoform that is 22 kDa, and is involved in the regulation of Myosin, which is a protein that conducts ATP hydrolysis. Current research is being conducted on the relationship between Myosin light chain 3 and a multitude of diseases and disorders, including familial hypertrophic cardiomyopathy, congestive heart failure, restrictive cardiomyopathy, dilated cardiomyopathy, diabetes mellitus, and renal failure. Myosin light chain 3 has been linked to the RhoA pathway, as well as PKA signaling, growth cone motility, cell adhesion, cardiac muscle contraction, and cytoskeleton remodeling. The protein interacts with YWHAQ, MYH13, YWHAZ, MYH9, and MYH7.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Myosin light chain 3 Antibody (NBP1-88068) (0)

There are no publications for Myosin light chain 3 Antibody (NBP1-88068).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Myosin light chain 3 Antibody (NBP1-88068) (0)

There are no reviews for Myosin light chain 3 Antibody (NBP1-88068). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Myosin light chain 3 Antibody (NBP1-88068) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Myosin light chain 3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MYL3