TPD52 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: TPD52 Antibody [NBP2-38952] - Staining in human prostate and skeletal muscle tissues using anti-TPD52 antibody. Corresponding TPD52 RNA-seq data are presented ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: TPD52 Antibody [NBP2-38952] - Staining of human cerebral cortex, kidney, prostate and skeletal muscle using Anti-TPD52 antibody NBP2-38952 (A) shows similar ...read more
Western Blot: TPD52 Antibody [NBP2-38952] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver ...read more
Immunocytochemistry/ Immunofluorescence: TPD52 Antibody [NBP2-38952] - Staining of human cell line A-431 shows positivity in cytoplasm and the Golgi apparatus.
Immunohistochemistry-Paraffin: TPD52 Antibody [NBP2-38952] - Staining of human kidney.
Immunohistochemistry-Paraffin: TPD52 Antibody [NBP2-38952] - Staining of human prostate shows high expression.
Immunohistochemistry-Paraffin: TPD52 Antibody [NBP2-38952] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: TPD52 Antibody [NBP2-38952] - Staining of human cerebral cortex.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TPD52 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: KSFEEKVENLKSKVGGTKPAGGDFGEVLNSAANASATTTEPLPEKTQESL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TPD52
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TPD52 Protein (NBP2-38952PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (80%), Rat (84%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TPD52 Antibody

  • D52
  • hD52
  • N8L
  • PC-1
  • PrLZ
  • prostate and colon associated protein
  • prostate leucine zipper
  • Protein N8
  • tumor protein D52

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TPD52 Antibody (NBP2-38952) (0)

There are no publications for TPD52 Antibody (NBP2-38952).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TPD52 Antibody (NBP2-38952) (0)

There are no reviews for TPD52 Antibody (NBP2-38952). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TPD52 Antibody (NBP2-38952) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TPD52 Products

Research Areas for TPD52 Antibody (NBP2-38952)

Find related products by research area.

Blogs on TPD52

There are no specific blogs for TPD52, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TPD52 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TPD52
Uniprot