Myeloperoxidase/MPO Antibody (3E11.)

Images

 
Western Blot: Myeloperoxidase/MPO Antibody (3E11) [H00004353-M01] - MPO monoclonal antibody (M01), clone 3E11. Analysis of MPO expression in Raw 264.7.
Western Blot: Myeloperoxidase/MPO Antibody (3E11) [H00004353-M01] - MPO monoclonal antibody (M01), clone 3E11. Analysis of MPO expression in Jurkat.
ELISA: Myeloperoxidase/MPO Antibody (3E11.) [H00004353-M01] - Myeloperoxidase/MPO Antibody (3E11) [H00004353-M01] - Detection limit for recombinant GST tagged MPO is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA
Clone
3E11.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Myeloperoxidase/MPO Antibody (3E11.) Summary

Immunogen
MPO (NP_000241 646 a.a. - 745 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GVSEPLKRKGRVGPLLACIIGTQFRKLRDGDRFWWENEGVFSMQQRQALAQISLPRIICDNTGITTVSKNNIFMSNSYPRDFVNCSTLPALNLASWREAS
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MPO
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
It has been used for ELISA and WB.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Myeloperoxidase/MPO Antibody (3E11.)

  • EC 1.11.1
  • EC 1.11.1.7
  • Lactoperoxidase
  • MPO
  • Myeloperoxidase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-25966
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
796-IC
Species: Mu
MAB9167
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP2-47415
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33778
Species: Hu
Applications: WB, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-05027
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, PEP-ELISA, S-ELISA
NBP2-13967
Species: Hu
Applications: IHC, IHC-P
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NB600-935
Species: Bv
Applications: WB, ELISA, IP
NB110-61574
Species: Hu, Mu, Bv, Gt, Sh
Applications: WB
NBP2-61118
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P

Publications for Myeloperoxidase/MPO Antibody (H00004353-M01) (0)

There are no publications for Myeloperoxidase/MPO Antibody (H00004353-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Myeloperoxidase/MPO Antibody (H00004353-M01) (0)

There are no reviews for Myeloperoxidase/MPO Antibody (H00004353-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Myeloperoxidase/MPO Antibody (H00004353-M01). (Showing 1 - 1 of 1 FAQ).

  1. Our laboratory would like to assess the extent of leukocyte infiltration into rabbit kidney induced by metabolic acidosis. We are currently exploring the feasibility of a myeloperoxidase assay utilizing antibody capture of myeloperoxidase for this purpose. Rabbit myeloperoxidase shares 88% and 86% identity with the human and mouse orthologues, respectively. Can you determine based on the immunogen, antibody epitope, or from direct testing data whether this antibody will cross-react with the rabbit orthologue?
    • Unfortunately, we have not mapped the actual epitope nor have we tested directly in rabbit. Based on the immunogen pf 646-743 aa. homology to rabbit we would say that there is definite cross reactivity with 85% homology. VSEP LKRKGRVGPL LACIIGTQFR KLRDGDRFWW ENEGVFSMQQ RQALAQISLP RIICDNTGIT TVSKNNIFMS NSYPRDFVNC STLPALNLAS WREAS I did check the other MPO antibodies and the problem is we do not have the exact epitope for any and when they use the full length for immunization then we cannot say for certain. However, with full length homology being 88% from human to rabbit is no good region of exclusivity.

Secondary Antibodies

 

Isotype Controls

Additional Myeloperoxidase/MPO Products

Bioinformatics Tool for Myeloperoxidase/MPO Antibody (H00004353-M01)

Discover related pathways, diseases and genes to Myeloperoxidase/MPO Antibody (H00004353-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Myeloperoxidase/MPO Antibody (H00004353-M01)

Discover more about diseases related to Myeloperoxidase/MPO Antibody (H00004353-M01).
 

Pathways for Myeloperoxidase/MPO Antibody (H00004353-M01)

View related products by pathway.

PTMs for Myeloperoxidase/MPO Antibody (H00004353-M01)

Learn more about PTMs related to Myeloperoxidase/MPO Antibody (H00004353-M01).
 

Research Areas for Myeloperoxidase/MPO Antibody (H00004353-M01)

Find related products by research area.

Blogs on Myeloperoxidase/MPO

There are no specific blogs for Myeloperoxidase/MPO, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Myeloperoxidase/MPO Antibody (3E11.) and receive a gift card or discount.

Bioinformatics

Gene Symbol MPO
Entrez
Uniprot