Myelin PLP Antibody - BSA Free

Western Blot: Myelin PLP Antibody [NBP1-60071] - 721_B cell lysate, Antibody Titration: 0.2-1 ug/ml.

Immunohistochemistry-Paraffin: Myelin PLP Antibody [NBP1-60071] - Human Brain, cerebellum tissue at an antibody concentration of 5ug/ml.

• Reactivity: Hu, Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Myelin PLP Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to PLP1(proteolipid protein 1 (Pelizaeus-Merzbacher disease, spastic paraplegia 2, uncomplicated)) The peptide sequence was selected from the N terminal of PLP1. Peptide sequence GHEALTGTEKLIETYFSKNYQDYEYLINVIHAFQYVIYGTASFFFLYGAL The peptide sequence for this immunogen was taken from within the described region.
• Marker: Oligodendrocyte Marker
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PLP1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 5 ug/ml
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Myelin PLP Antibody - BSA Free

• DM-20
• HLD1
• Lipophilin
• major myelin proteolipid protein
• MMPL
• Myelin PLP
• myelin proteolipid protein
• PLP
• PLP/DM20
• PLP1
• PMD
• proteolipid protein 1
• spastic paraplegia 2, uncomplicated
• SPG2

Background

PLP1 is a transmembrane proteolipid protein that is the predominant myelin protein present in the central nervous system. It may play a role in the compaction, stabilization, and maintenance of myelin sheaths, as well as in oligodendrocyte development and axonal survival. Mutations in this gene cause X-linked Pelizaeus-Merzbacher disease and spastic paraplegia type 2. Alternatively spliced transcript variants encoding distinct isoforms or having different 5' UTRs, have been identified for this gene.This gene encodes a transmembrane proteolipid protein that is the predominant myelin protein present in the central nervous system. It may play a role in the compaction, stabilization, and maintenance of myelin sheaths, as well as in oligodendrocyte development and axonal survival. Mutations in this gene cause X-linked Pelizaeus-Merzbacher disease and spastic paraplegia type 2. Alternatively spliced transcript variants encoding distinct isoforms or having different 5' UTRs, have been identified for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PLP1
• Uniprot:
  • P60201(Human)