Mxi1 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: RERECEHGYASSFPSMPSPRLQHSKPPRRLSRAQKHSSGSSNTSTANRSTHNELEKNRRAHLRLCLERLKVLIPLGP |
| Predicted Species |
Mouse (100%), Rat (100%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
MXI1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
| Application Notes |
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Mxi1 Antibody - BSA Free
Background
Expression of the c-myc gene, which produces an oncogenic transcription factor, is tightly regulated in normal cells but is frequently deregulated in human cancers. The protein encoded by this gene is a transcriptional repressor thought to negatively regulate MYC function, and is therefore a potential tumor suppressor. This protein inhibits the transcriptional activity of MYC by competing for MAX, another basic helix-loop-helix protein that binds to MYC and is required for its function. Defects in this gene are frequently found in patients with prostate tumors. Three alternatively spliced transcripts encoding different isoforms have been described. Additional alternatively spliced transcripts may exist but the products of these transcripts have not been verified experimentally.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ChIP-EXO-SEQ, IHC, IHC-P
Species: Hu, Mar, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, IP, WB
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Mu
Applications: IP, WB
Species: Hu, Mu
Applications: ICC/IF, PLA, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: IHC, IHC-P
Species: Bv, Ca, Hu, Mu, Ma-Op, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, Single-Cell Western, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, KO, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Publications for Mxi1 Antibody (NBP3-21258) (0)
There are no publications for Mxi1 Antibody (NBP3-21258).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Mxi1 Antibody (NBP3-21258) (0)
There are no reviews for Mxi1 Antibody (NBP3-21258).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Mxi1 Antibody (NBP3-21258) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Mxi1 Products
Research Areas for Mxi1 Antibody (NBP3-21258)
Find related products by research area.
|
Blogs on Mxi1