Mxi1 Antibody


Western Blot: Mxi1 Antibody [NBP1-88626] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with more
Immunohistochemistry-Paraffin: Mxi1 Antibody [NBP1-88626] - Staining of human colon shows strong nuclear and cytoplasmic positivity in glandular cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

Mxi1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:HTTLGLLNKAKAHIKKLEEAERKSQHQLENLEREQRFLKWRLEQLQGPQEMERIRM
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Mxi1 Protein (NBP1-88626PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Mxi1 Antibody

  • BHLHC11
  • Class C basic helix-loop-helix protein 11
  • MAD2
  • MAX dimerization protein 2
  • MAX interacting protein 1
  • MAX interactor 1bHLHc11MAD2
  • max-interacting protein 1
  • Max-related transcription factor
  • MGC43220
  • MXD2
  • MXI
  • Mxi1
  • MXI-WR


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC-P, IP
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, IP
Species: Hu, Mu
Applications: WB, ICC/IF, PLA
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, PEP-ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt, Po, Bv, Ch, Xp, Ze
Applications: WB, ELISA, Flow, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
Species: Hu
Applications: WB, PEP-ELISA
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC

Publications for Mxi1 Antibody (NBP1-88626) (0)

There are no publications for Mxi1 Antibody (NBP1-88626).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Mxi1 Antibody (NBP1-88626) (0)

There are no reviews for Mxi1 Antibody (NBP1-88626). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Mxi1 Antibody (NBP1-88626) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Mxi1 Products

Bioinformatics Tool for Mxi1 Antibody (NBP1-88626)

Discover related pathways, diseases and genes to Mxi1 Antibody (NBP1-88626). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Mxi1 Antibody (NBP1-88626)

Discover more about diseases related to Mxi1 Antibody (NBP1-88626).

Pathways for Mxi1 Antibody (NBP1-88626)

View related products by pathway.

PTMs for Mxi1 Antibody (NBP1-88626)

Learn more about PTMs related to Mxi1 Antibody (NBP1-88626).

Research Areas for Mxi1 Antibody (NBP1-88626)

Find related products by research area.

Blogs on Mxi1

There are no specific blogs for Mxi1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Mxi1 Antibody and receive a gift card or discount.


Gene Symbol MXI1