Mxi1 Antibody

Images

 
Immunohistochemistry-Paraffin: Mxi1 Antibody [NBP1-88626] - Staining of human cerebral cortex shows moderate to strong nuclear positivity in neurons.
Immunohistochemistry-Paraffin: Mxi1 Antibody [NBP1-88626] - Staining of human colon shows moderate to strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: Mxi1 Antibody [NBP1-88626] - Staining of human skin shows moderate to strong nuclear positivity in epidermal cells.
Immunohistochemistry-Paraffin: Mxi1 Antibody [NBP1-88626] - Staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Mxi1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: HTTLGLLNKAKAHIKKLEEAERKSQHQLENLEREQRFLKWRLEQLQGPQEMERIRM
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MXI1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Mxi1 Protein (NBP1-88626PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Mxi1 Antibody

  • BHLHC11
  • Class C basic helix-loop-helix protein 11
  • MAD2
  • MAX dimerization protein 2
  • MAX interacting protein 1
  • MAX interactor 1bHLHc11MAD2
  • max-interacting protein 1
  • Max-related transcription factor
  • MGC43220
  • MXD2
  • MXI
  • Mxi1
  • MXI-WR

Background

Expression of the c-myc gene, which produces an oncogenic transcription factor, is tightly regulated in normal cells but is frequently deregulated in human cancers. The protein encoded by this gene is a transcriptional repressor thought to negatively regulate MYC function, and is therefore a potential tumor suppressor. This protein inhibits the transcriptional activity of MYC by competing for MAX, another basic helix-loop-helix protein that binds to MYC and is required for its function. Defects in this gene are frequently found in patients with prostate tumors. Three alternatively spliced transcripts encoding different isoforms have been described. Additional alternatively spliced transcripts may exist but the products of these transcripts have not been verified experimentally.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-85249
Species: Hu, Mu
Applications: WB
NBP1-32775
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
NB100-563
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NB100-59828
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
NB100-353
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, IP, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NB100-91662
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-86509
Species: Hu
Applications: IHC, IHC-P
H00000699-D01P
Species: Hu, Mu
Applications: ICC/IF, PLA, WB
NBP1-88517
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP3-12270
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-24509
Species: Bv, Ca, Hu, Mu, Ma-Op, Pm, Rt
Applications: IHC, IHC-P, WB
MAB6028
Species: Hu
Applications: WB
NB100-793
Species: Hu, Rt
Applications: IF, IHC, IHC-P, PEP-ELISA, WB
NBP3-19989
Species: Hu, Mu, Rt
Applications: WB
NB100-56479
Species: Bv, Ca, Hu, Mu, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-56507
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, KO, Simple Western, WB
NB100-1103
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP2-20287
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB

Publications for Mxi1 Antibody (NBP1-88626) (0)

There are no publications for Mxi1 Antibody (NBP1-88626).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Mxi1 Antibody (NBP1-88626) (0)

There are no reviews for Mxi1 Antibody (NBP1-88626). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Mxi1 Antibody (NBP1-88626) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Mxi1 Products

Diseases for Mxi1 Antibody (NBP1-88626)

Discover more about diseases related to Mxi1 Antibody (NBP1-88626).
 

Pathways for Mxi1 Antibody (NBP1-88626)

View related products by pathway.

PTMs for Mxi1 Antibody (NBP1-88626)

Learn more about PTMs related to Mxi1 Antibody (NBP1-88626).
 

Research Areas for Mxi1 Antibody (NBP1-88626)

Find related products by research area.

Blogs on Mxi1

There are no specific blogs for Mxi1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Mxi1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MXI1