Muscle Phosphofructokinase/PFKM/PFK-1 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: CVQVTKDVTKAMDEKKFDEALKLRGRSFMNNWEVYKLLAHVRPPVSKSGSHTVAVMNVGAPAAGMNAAVRSTVRIGLIQGNRVLVVHDGFEGLAKGQIEEAGWSYVGGWTGQGGSKLGTKRTLPKKSFEQISA |
| Predicted Species |
Mouse (95%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
PFKM |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Muscle Phosphofructokinase/PFKM/PFK-1 Antibody - BSA Free
Background
Phosphofructokinases (PFK) are regulatory glycolytic enzymes that convert fructose 6-phosphate and ATP into fructose 1,6-bisphosphate (through PFK-1), fructose 2,6-bisphosphate (through PFK-2) and ADP. Human PFK-1 is tetrameric and isoenzymes include PFK-1 muscle (PFKM, PFK-A), PFK-1 liver (PFKL, PFK-B) and PFK-1 platelet (PFKP, PFK-C, PFKF). PFK-1 is inhibited by ATP and citrate (from the tricarboxylic acid cycle). PFK-1 undergoes activation in the presence of elevated AMP. The most potent activator is fructose 2,6-bisphosphate, which is produced by PFK-2 from the same substrate, fructose 6-phosphate. PFK-2 is bifunctional and a key regulator for PFK-1. PFK-2 catalyzes the synthesis of fructose 2,6-bisphosphate and contains fructose 2,6-biphosphatase activity that catalyzes the degradation of fructose 2,6-bisphosphate. PFK-2 is dimeric and isoenzymes include PFK-2 liver (PFKFB1, PFRX), PFK-2 cardiac (PFKFB2), PFK-2 placental (PFKFB3, inducible PFK-2) and PFK-2 testis (PFKFB4).
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ELISA, IP, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
Species: Hu, Mu, Rb, Rt
Applications: ChIP, ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, Simple Western, WB
Species: Hu
Applications: IHC, WB
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
Species: Mu, Rt
Applications: ICC/IF, WB
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IB, IHC, IHC-Fr, WB
Species: Bv, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, WB
Species: Bv, Ca, Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Publications for Muscle Phosphofructokinase/PFKM/PFK-1 Antibody (NBP1-87293) (0)
There are no publications for Muscle Phosphofructokinase/PFKM/PFK-1 Antibody (NBP1-87293).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Muscle Phosphofructokinase/PFKM/PFK-1 Antibody (NBP1-87293) (0)
There are no reviews for Muscle Phosphofructokinase/PFKM/PFK-1 Antibody (NBP1-87293).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Muscle Phosphofructokinase/PFKM/PFK-1 Antibody (NBP1-87293) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Muscle Phosphofructokinase/PFKM/PFK-1 Products
Research Areas for Muscle Phosphofructokinase/PFKM/PFK-1 Antibody (NBP1-87293)
Find related products by research area.
|
Blogs on Muscle Phosphofructokinase/PFKM/PFK-1