6 Phosphofructo 2 Kinase Antibody (3F3)

Images

 
Western Blot: 6 Phosphofructo 2 Kinase Antibody (3F3) [H00005209-M08] - Analysis of PFKFB3 expression in transfected 293T cell line by PFKFB3 monoclonal antibody (M08), clone 3F3. Lane 1: PFKFB3 transfected lysatE (59.6 ...read more
Western Blot: 6 Phosphofructo 2 Kinase Antibody (3F3) [H00005209-M08] - Analysis of PFKFB3 transfected lysate using anti-PFKFB3 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PFKFB3 rabbit ...read more
ELISA: 6 Phosphofructo 2 Kinase Antibody (3F3) [H00005209-M08] - Detection limit for recombinant GST tagged PFKFB3 is approximately 3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IP
Clone
3F3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

6 Phosphofructo 2 Kinase Antibody (3F3) Summary

Immunogen
PFKFB3 (NP_004557 412 a.a. - 520 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. CPLHTVLKLTPVAYGCRVESIYLNVESVCTHRERSEDAKKGPNPLMRRNSVTPLASPEPTKKPRINSFEEHVASTSAALPSCLPPEVPTQLPGQNMKGSRSSADSSRKH
Specificity
PFKFB3 - 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3 (3F3)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PFKFB3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunoprecipitation
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Control
6 Phosphofructo 2 Kinase Lysate (NBP2-65658)
Reviewed Applications
Read 1 Review rated 4
using
H00005209-M08 in the following applications:

Publications
Read Publications using
H00005209-M08 in the following applications:

  • WB
    7 publications

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for 6 Phosphofructo 2 Kinase Antibody (3F3)

  • 6 Phosphofructo 2 Kinase
  • 6PF-2-K/Fru-2,6-P2ase 3,6-bisphosphatase
  • 6-phosphofructo-2-kinase/ fructose-2,6-bisphosphatase
  • 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3,6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase
  • FLJ37326
  • inducible 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase
  • IPFK2
  • PFK/FBPase 3
  • PFK2
  • PFKFB3
  • Renal carcinoma antigen NY-REN-56

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87293
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-47778
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
H00008458-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NB100-105
Species: Hu, Mu, Rt, Po, Bv, Ft, Mk, Pm, Rb, Sh, Xp
Applications: WB, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, TCS, KO, LA
NBP1-32538
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF2850
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP2-22127
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
H00005564-M02
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP2-66987
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-39113
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
NBP2-67503
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-45238
Species: Hu, Bv, Ca
Applications: WB, IHC, IHC-P, PEP-ELISA
7270-IL/CF
Species: Hu
NBP2-03396
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00005209-M08
Species: Hu
Applications: WB, ELISA, IP

Publications for 6 Phosphofructo 2 Kinase Antibody (H00005209-M08)(10)

We have publications tested in 3 confirmed species: Human, Mouse, Rat.

We have publications tested in 1 application: WB.


Filter By Application
WB
(7)
All Applications
Filter By Species
Human
(4)
Mouse
(1)
Rat
(1)
All Species
Showing Publications 1 - 10 of 10.
Publications using H00005209-M08 Applications Species
Ohmura M, Hishiki T, Yamamoto T et al. Impacts of CD44 knockdown in cancer cells on tumor and host metabolic systems revealed by quantitative imaging mass spectrometry. Nitric Oxide. 2014 [PMID: 25461272]
Desideri E, Vegliante R, Cardaci S et al. MAPK14/p38alpha-dependent modulation of glucose metabolism affects ROS levels and autophagy during starvation. Autophagy 2014 Sep [PMID: 25046111] (WB) WB
Yamamoto Takehiro, Takano Naoharu, Ishiwata Kyoko et al. Reduced methylation of PFKFB3 in cancer cells shunts glucose towards the pentose phosphate pathway. Nat Commun. 2014 Mar 17 [PMID: 24633012] (WB, Human) WB Human
Cordero-Espinoza L, Hagen T. Increased concentrations of Fructose-2,6-bisphosphate contribute to the Warburg effect in PTEN-deficient cells. J Biol Chem. 2013 Oct 29 [PMID: 24169697] (WB, Mouse) WB Mouse
Bao Y, Mukai K, Hishiki T et al. Energy management by enhanced glycolysis in G1-phase in human colon cancer cells in vitro and in vivo. Mol Cancer Res. 2013 Sep [PMID: 23741060] (WB, Human) WB Human
Huang Y, Bell LN, Okamura J et al. Phospho-deltaNp63alpha/SREBF1 protein interactions: Bridging cell metabolism and cisplatin chemoresistance Cell Cycle 2012 Sep 5 [PMID: 22951905] (WB, Human) WB Human
Rodriguez-Rodriguez P, Fernandez E et al. Excitotoxic stimulus stabilizes PFKFB3 causing pentose-phosphate pathway to glycolysis switch and neurodegeneration Cell Death Differ 2012 Mar 16 [PMID: 22421967] (WB, Rat) WB Rat
Almeida A, Bolanos JP, Moncada Set. E3 ubiquitin ligase APC/C-Cdh1 accounts for the Warburg effect by linking glycolysis to cell proliferation. Proc Natl Acad Sci U S A 2010 Jan 12 [PMID: 20080744] (WB, Human) WB Human
Amako Y, Sarkeshik A, Hotta H et al. Role of Oxysterol Binding Protein in Hepatitis C Virus infection. J Virol;83(18):9237-9246. 2009 [PMID: 19570870]
Yalcin A, Clem BF, Simmons A et al. Nuclear Targeting of 6-Phosphofructo-2-kinase (PFKFB3) Increases Proliferation via Cyclin-dependent Kinases. J Biol Chem;284(36):24223-24232. 2009 [PMID: 19473963]

Review for 6 Phosphofructo 2 Kinase Antibody (H00005209-M08) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using H00005209-M08:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot 6 Phosphofructo 2 Kinase H00005209-M08
Enlarge
reviewed by:
Amy Clem
WB Human 12/08/2010
View

Summary

ApplicationWestern Blot
Sample TestedA549 Nuclear and cytoplasmic, Sample Amount: 30ug
SpeciesHuman
Lot10194-3F3
Comments"Additional bands diminished upon further usage of antibody which we prepared in sodium azide."

Blocking

Blocking DetailsBlocking Buffer: 5% Milkin TBST, Blocking Time: 1 hour, Blocking Temp: Room temperature

Primary Anitbody

Dilution RatioDilution Ratio: 1:500, Incubation Dilution Buffer: 2% Milk in TBST, Incubation Time: overnight, Incubation Temp: 4 C

Secondary Antibody

Secondary DescriptionSecondary Ab: goat anti-mouse, Secondary Ab Dilution Ratio: 1:10000
Secondary Manufacturer Cat#31430

Details

Detection NotesMethod: ECL Plus, Exposure Time: 15 sec., Positive Control: recombinant protein, Bands: 54kDa(specific), 80,34kDa(non-specific)

Comments

Comments"Additional bands diminished upon further usage of antibody which we prepared in sodium azide."

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for 6 Phosphofructo 2 Kinase Antibody (H00005209-M08) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for 6 Phosphofructo 2 Kinase Antibody (H00005209-M08)

Discover related pathways, diseases and genes to 6 Phosphofructo 2 Kinase Antibody (H00005209-M08). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for 6 Phosphofructo 2 Kinase Antibody (H00005209-M08)

Discover more about diseases related to 6 Phosphofructo 2 Kinase Antibody (H00005209-M08).
 

Pathways for 6 Phosphofructo 2 Kinase Antibody (H00005209-M08)

View related products by pathway.

PTMs for 6 Phosphofructo 2 Kinase Antibody (H00005209-M08)

Learn more about PTMs related to 6 Phosphofructo 2 Kinase Antibody (H00005209-M08).

Blogs on 6 Phosphofructo 2 Kinase

There are no specific blogs for 6 Phosphofructo 2 Kinase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Amy Clem
12/08/2010
Application: WB
Species: Human

Bioinformatics

Gene Symbol PFKFB3
Entrez
Uniprot