6 Phosphofructo 2 Kinase Antibody (3F3)

Images

 
Western Blot: 6 Phosphofructo 2 Kinase Antibody (3F3) [H00005209-M08] - Analysis of PFKFB3 expression in transfected 293T cell line by PFKFB3 monoclonal antibody (M08), clone 3F3. Lane 1: PFKFB3 transfected lysatE (59.6 ...read more
Western Blot: 6 Phosphofructo 2 Kinase Antibody (3F3) [H00005209-M08] - Analysis of PFKFB3 transfected lysate using anti-PFKFB3 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PFKFB3 rabbit ...read more
ELISA: 6 Phosphofructo 2 Kinase Antibody (3F3) [H00005209-M08] - Detection limit for recombinant GST tagged PFKFB3 is approximately 3ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, IP
Clone
3F3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

6 Phosphofructo 2 Kinase Antibody (3F3) Summary

Immunogen
PFKFB3 (NP_004557, 412 a.a. ~ 520 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. CPLHTVLKLTPVAYGCRVESIYLNVESVCTHRERSEDAKKGPNPLMRRNSVTPLASPEPTKKPRINSFEEHVASTSAALPSCLPPEVPTQLPGQNMKGSRSSADSSRKH
Specificity
PFKFB3 - 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3 (3F3)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PFKFB3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoprecipitation 1:10-1:500
  • Western Blot 1:500
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Reviewed Applications
Read 1 Review rated 4
using
H00005209-M08 in the following applications:

Publications
Read Publications using
H00005209-M08 in the following applications:

  • WB
    10 publications

Reactivity Notes

Rat reactivity reported in scientific literature (PMID: 22421967). Mouse reactivity reported in scientific literature (PMID: 24169697).

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for 6 Phosphofructo 2 Kinase Antibody (3F3)

  • 6 Phosphofructo 2 Kinase
  • 6PF-2-K/Fru-2,6-P2ase 3,6-bisphosphatase
  • 6-phosphofructo-2-kinase/ fructose-2,6-bisphosphatase
  • 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3,6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase
  • FLJ37326
  • inducible 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase
  • IPFK2
  • PFK/FBPase 3
  • PFK2
  • PFKFB3
  • Renal carcinoma antigen NY-REN-56

Background

Synthesis and degradation of fructose 2,6-bisphosphate

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-32169
Species: Hu, Mu
Applications: IP, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP1-47778
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-58268
Species: Hu, Mu
Applications: IHC, IHC-P, WB
H00008458-M06
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NB100-105
Species: Bv, Ca, Fe, Ma, Hu, Pm, Mu, Po, Pm, Rb, Rt, Sh, Xp
Applications: ChIP, ELISA, Flow, GS, IA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, KO, LA, PLA, Simple Western, TCS, WB
NBP1-32538
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF2850
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
NBP2-22127
Species: Hu, Mu, Pm, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
AF2854
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP1-86509
Species: Hu
Applications: IHC, IHC-P
NB100-91662
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB110-39113
Species: Hu, Mu, Rb, Rt
Applications: ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, Simple Western, WB
NBP1-31600
Species: Bv, Hu, Ze
Applications: ICC/IF, IHC-WhMt, IHC, IHC-P, WB
DVE00
Species: Hu
Applications: ELISA
NBP1-45238
Species: Bv, Ca, Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
D6050
Species: Hu
Applications: ELISA
NBP2-03396
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB

Publications for 6 Phosphofructo 2 Kinase Antibody (H00005209-M08)(13)

We have publications tested in 3 confirmed species: Human, Mouse, Rat.

We have publications tested in 1 application: WB.


Filter By Application
WB
(10)
All Applications
Filter By Species
Human
(5)
Mouse
(3)
Rat
(1)
All Species
Showing Publications 1 - 10 of 13. Show All 13 Publications.
Publications using H00005209-M08 Applications Species
Lopez-Fabuel I, Garcia-Macia M, Buondelmonte C et al. Aberrant upregulation of the glycolytic enzyme PFKFB3 in CLN7 neuronal ceroid lipofuscinosis Nature communications 2022-01-27 [PMID: 35087090] (WB, Mouse) WB Mouse
Burmistrova O, Olias-Arjona A, Lapresa R et al. Targeting PFKFB3 alleviates cerebral ischemia-reperfusion injury in mice Sci Rep 2019-08-12 [PMID: 31406177] (WB, Mouse) WB Mouse
RodrIguez C, SAnchez-MorAn I, Alvarez S et al. A novel human Cdh1 mutation impairs anaphase promoting complex/cyclosome (APC/C) activity resulting in microcephaly, psychomotor retardation and epilepsy J. Neurochem. 2019-07-18 [PMID: 31318984] (WB, Human) WB Human
Ohmura M, Hishiki T, Yamamoto T et al. Impacts of CD44 knockdown in cancer cells on tumor and host metabolic systems revealed by quantitative imaging mass spectrometry. Nitric Oxide. 2014-01-01 [PMID: 25461272]
Desideri E, Vegliante R, Cardaci S et al. MAPK14/p38alpha-dependent modulation of glucose metabolism affects ROS levels and autophagy during starvation. Autophagy 2014-09-01 [PMID: 25046111] (WB) WB
Yamamoto Takehiro, Takano Naoharu, Ishiwata Kyoko et al. Reduced methylation of PFKFB3 in cancer cells shunts glucose towards the pentose phosphate pathway. Nat Commun. 2014-03-17 [PMID: 24633012] (WB, Human) WB Human
Cordero-Espinoza L, Hagen T. Increased concentrations of Fructose-2,6-bisphosphate contribute to the Warburg effect in PTEN-deficient cells. J Biol Chem. 2013-10-29 [PMID: 24169697] (WB, Mouse) WB Mouse
Bao Y, Mukai K, Hishiki T et al. Energy management by enhanced glycolysis in G1-phase in human colon cancer cells in vitro and in vivo. Mol Cancer Res. 2013-09-01 [PMID: 23741060] (WB, Human) WB Human
Huang Y, Bell LN, Okamura J et al. Phospho-deltaNp63alpha/SREBF1 protein interactions: Bridging cell metabolism and cisplatin chemoresistance Cell Cycle 2012-09-05 [PMID: 22951905] (WB, Human) WB Human
Rodriguez-Rodriguez P, Fernandez E et al. Excitotoxic stimulus stabilizes PFKFB3 causing pentose-phosphate pathway to glycolysis switch and neurodegeneration Cell Death Differ 2012-03-16 [PMID: 22421967] (WB, Rat) WB Rat
Show All 13 Publications.

Review for 6 Phosphofructo 2 Kinase Antibody (H00005209-M08) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using H00005209-M08:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot 6 Phosphofructo 2 Kinase H00005209-M08
Enlarge
4
reviewed by:
Verified Customer
WB Human 12/08/2010
View

Summary

ApplicationWestern Blot
Sample TestedA549 Nuclear and cytoplasmic, Sample Amount: 30ug
SpeciesHuman
Lot10194-3F3

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for 6 Phosphofructo 2 Kinase Antibody (H00005209-M08) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional 6 Phosphofructo 2 Kinase Products

Bioinformatics Tool for 6 Phosphofructo 2 Kinase Antibody (H00005209-M08)

Discover related pathways, diseases and genes to 6 Phosphofructo 2 Kinase Antibody (H00005209-M08). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for 6 Phosphofructo 2 Kinase Antibody (H00005209-M08)

Discover more about diseases related to 6 Phosphofructo 2 Kinase Antibody (H00005209-M08).
 

Pathways for 6 Phosphofructo 2 Kinase Antibody (H00005209-M08)

View related products by pathway.

PTMs for 6 Phosphofructo 2 Kinase Antibody (H00005209-M08)

Learn more about PTMs related to 6 Phosphofructo 2 Kinase Antibody (H00005209-M08).

Blogs on 6 Phosphofructo 2 Kinase

There are no specific blogs for 6 Phosphofructo 2 Kinase, but you can read our latest blog posts.
Download our IHC Handbook

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Verified Customer
12/08/2010
Application: WB
Species: Human

Bioinformatics

Gene Symbol PFKFB3
Entrez
Uniprot