MUC5AC Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

MUC5AC Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MUC5AC
  
  

  Source: E.coli

  Amino Acid Sequence: LLSHNTKLTPMEFGNLQKMDDPTEQCQDPVPEPPRNCSTGFGICEELLHGQLFSGCVALVDVGSYLEACRQDLCFCE

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: MUC5AC
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-25001It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MUC5AC Recombinant Protein Antigen

• gastric mucin
• leB
• lewis B blood group antigen
• major airway glycoprotein
• MUC5
• mucin 5, subtypes A and C, tracheobronchial/gastric
• mucin 5AC, oligomeric mucus/gel-forming pseudogene
• mucin 5AC, oligomeric mucus/gel-forming
• mucin-5 subtype AC, tracheobronchial
• mucin-5AC
• TBM
• tracheobronchial mucin

Background

Mucin 5, subtype AC (MUC5AC) is a gel-forming secreted mucin that functions as a protective barrier on surface of epithelial tissues (1-2). MUC5AC is expressed primarily by goblet cells of the surface epithelium, including in the stomach, respiratory tract, gall bladder, endocervix, and endometrium (1-3). Human MUC5AC is located on chromosome 11p15.5, consisting of 5654 amino acids and has a N-terminus, tandem-repeat region (TRR), and a C-terminus, with a theoretical molecular weight of ~585 kDa (1-4). More specifically, the N-terminus contains four von Willebrand factor type D domains, where D1 also has a leucine zipper pattern (1). The TRR is further divided into nine CysD domains and four PTS-rich tandem repeats (1). Finally, the C-terminus has a D4-, B-, C-, and CK-domain (1). The TRR is a site of heavy O-glycosylation that functions in gel and polypeptide formation (1,3).

Given that MUC5AC is the primary mucin produced and secreted by cells lining airway, it is understandable that its expression is dysregulated in a number of respiratory diseases (1,3,5,6). For instance, MUC5AC is overexpressed in asthma and the protein is also more highly glycosylated, specifically fucosylated, in the disease state (1,3,7). Additionally, its overproduction is a key feature in chronic obstructive pulmonary disease (COPD) contributing to mucosal blockage (6). Multiple pathways are associated with overproduction of MUC5AC including NFkappaB, the primary pathway for production and secretion, and also the MAPK and STAT6 pathways (3). In addition to conventional, synthetic therapeutics agents, researchers are exploring natural MUC5AC inhibitors such as flavonoids, glycosides, and steroids to treat associated disorders (3).

References

1. Krishn, S. R., Ganguly, K., Kaur, S., & Batra, S. K. (2018). Ramifications of secreted mucin MUC5AC in malignant journey: a holistic view. Carcinogenesis. https://doi.org/10.1093/carcin/bgy019

2. Ballester, B., Milara, J., & Cortijo, J. (2019). Mucins as a New Frontier in Pulmonary Fibrosis. Journal of clinical medicine. https://doi.org/10.3390/jcm8091447

3. Samsuzzaman, M., Uddin, M. S., Shah, M. A., & Mathew, B. (2019). Natural inhibitors on airway mucin: Molecular insight into the therapeutic potential targeting MUC5AC expression and production. Life sciences. https://doi.org/10.1016/j.lfs.2019.05.041

4. Uniprot (P98088)

5. Li, J., & Ye, Z. (2020). The Potential Role and Regulatory Mechanisms of MUC5AC in Chronic Obstructive Pulmonary Disease. Molecules (Basel, Switzerland). https://doi.org/10.3390/molecules25194437

6. Bonser, L. R., & Erle, D. J. (2017). Airway Mucus and Asthma: The Role of MUC5AC and MUC5B. Journal of clinical medicine. https://doi.org/10.3390/jcm6120112

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MUC5AC