MUC5AC Recombinant Protein Antigen

Images

 
There are currently no images for MUC5AC Recombinant Protein Antigen (NBP2-31986PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

MUC5AC Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MUC5AC.

Source: E. coli

Amino Acid Sequence: LDDIGQTGCVPVSKCACVYNGAAYAPGATYSTDCTNCTCSGGRWSCQEVPCPG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MUC5AC
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-31986.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MUC5AC Recombinant Protein Antigen

  • gastric mucin
  • leB
  • lewis B blood group antigen
  • major airway glycoprotein
  • MUC5
  • mucin 5, subtypes A and C, tracheobronchial/gastric
  • mucin 5AC, oligomeric mucus/gel-forming pseudogene
  • mucin 5AC, oligomeric mucus/gel-forming
  • mucin-5 subtype AC, tracheobronchial
  • mucin-5AC
  • TBM
  • tracheobronchial mucin

Background

Mucin 5, subtype AC (MUC5AC) is a gel-forming secreted mucin that functions as a protective barrier on surface of epithelial tissues (1-2). MUC5AC is expressed primarily by goblet cells of the surface epithelium, including in the stomach, respiratory tract, gall bladder, endocervix, and endometrium (1-3). Human MUC5AC is located on chromosome 11p15.5, consisting of 5654 amino acids and has a N-terminus, tandem-repeat region (TRR), and a C-terminus, with a theoretical molecular weight of ~585 kDa (1-4). More specifically, the N-terminus contains four von Willebrand factor type D domains, where D1 also has a leucine zipper pattern (1). The TRR is further divided into nine CysD domains and four PTS-rich tandem repeats (1). Finally, the C-terminus has a D4-, B-, C-, and CK-domain (1). The TRR is a site of heavy O-glycosylation that functions in gel and polypeptide formation (1,3).

Given that MUC5AC is the primary mucin produced and secreted by cells lining airway, it is understandable that its expression is dysregulated in a number of respiratory diseases (1,3,5,6). For instance, MUC5AC is overexpressed in asthma and the protein is also more highly glycosylated, specifically fucosylated, in the disease state (1,3,7). Additionally, its overproduction is a key feature in chronic obstructive pulmonary disease (COPD) contributing to mucosal blockage (6). Multiple pathways are associated with overproduction of MUC5AC including NFkappaB, the primary pathway for production and secretion, and also the MAPK and STAT6 pathways (3). In addition to conventional, synthetic therapeutics agents, researchers are exploring natural MUC5AC inhibitors such as flavonoids, glycosides, and steroids to treat associated disorders (3).

References

1. Krishn, S. R., Ganguly, K., Kaur, S., & Batra, S. K. (2018). Ramifications of secreted mucin MUC5AC in malignant journey: a holistic view. Carcinogenesis. https://doi.org/10.1093/carcin/bgy019

2. Ballester, B., Milara, J., & Cortijo, J. (2019). Mucins as a New Frontier in Pulmonary Fibrosis. Journal of clinical medicine. https://doi.org/10.3390/jcm8091447

3. Samsuzzaman, M., Uddin, M. S., Shah, M. A., & Mathew, B. (2019). Natural inhibitors on airway mucin: Molecular insight into the therapeutic potential targeting MUC5AC expression and production. Life sciences. https://doi.org/10.1016/j.lfs.2019.05.041

4. Uniprot (P98088)

5. Li, J., & Ye, Z. (2020). The Potential Role and Regulatory Mechanisms of MUC5AC in Chronic Obstructive Pulmonary Disease. Molecules (Basel, Switzerland). https://doi.org/10.3390/molecules25194437

6. Bonser, L. R., & Erle, D. J. (2017). Airway Mucus and Asthma: The Role of MUC5AC and MUC5B. Journal of clinical medicine. https://doi.org/10.3390/jcm6120112

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-11197
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF (-), IHC, IHC-Fr,  IHC-P, WB
NB120-22711
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P
NBP2-44374
Species: Hu
Applications: Flow, ICC/IF, IF, IHC,  IHC-P, IP, WB
NBP1-92151
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
H00004585-M07
Species: Hu, Mu
Applications: ELISA, IHC,  IHC-P, WB
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
DY413
Species: Mu
Applications: ELISA
NBP2-67309
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
AF1126
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
NBP2-47940
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IF, IHC,  IHC-P, Simple Western, WB
NBP2-44434
Species: Hu, Rt(-)
Applications: Flow, ICC/IF, IF, IHC,  IHC-P
NBP2-24583
Species: Bv, Eq, Hu, Mu, Ma-Op, Pm, Rt
Applications: IHC,  IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
DY4517-05
Species: Mu
Applications: ELISA
236-EG
Species: Hu
Applications: BA
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-82045
Species: Hu
Applications: IHC,  IHC-P
NBP2-31986PEP
Species: Hu
Applications: AC

Publications for MUC5AC Recombinant Protein Antigen (NBP2-31986PEP) (0)

There are no publications for MUC5AC Recombinant Protein Antigen (NBP2-31986PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MUC5AC Recombinant Protein Antigen (NBP2-31986PEP) (0)

There are no reviews for MUC5AC Recombinant Protein Antigen (NBP2-31986PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MUC5AC Recombinant Protein Antigen (NBP2-31986PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MUC5AC Products

Research Areas for MUC5AC Recombinant Protein Antigen (NBP2-31986PEP)

Find related products by research area.

Blogs on MUC5AC.

Spheroids vs. Organoids: Which 3D Cell Culture Model is Best for You?
By Jennifer Jones, M.S.Spheroids and organoids are two words that, like “butter” and “margarine”, are often referred to interchangeably but have distinct meanings. The progression and adopt...  Read full blog post.

Customers Who Bought This Also Bought

MUC5AC Antibody (45M1)
NBP2-15196-0.1mg

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MUC5AC Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MUC5AC