MUC3B Antibody

Images

 
Western Blot: MUC3B Antibody [NBP1-70644] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MUC3B Antibody Summary

Immunogen
Synthetic peptides corresponding to MUC3B(intestinal mucin MUC3B precursor) The peptide sequence was selected from the N terminal of MUC3B. Peptide sequence MLCADVVETEVGMEVSVDQQFSPDLNDNTSQAYRDFNKTFWNQMQKIFAD.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MUC3B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against MUC3B and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MUC3B Antibody

  • intestinal mucin MUC3B
  • intestinal mucin-3B
  • MUC3
  • MUC-3B
  • mucin 3B, cell surface associated
  • mucin-3B

Background

MUC3B is major glycoprotein component of a variety of mucus gels. It is thought to provide a protective, lubricating barrier against particles and infectious agents at mucosal surfaces.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-11197
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-Fr, IHC-P
NB120-22711
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-52193
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-15196
Species: Hu, Mu, Rt, Po, Ch, Fe, Pm, Rb, Bv(-)
Applications: Flow, ICC/IF, IHC-Fr, IHC-P, Flow-IC
NBP1-92151
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-44374
Species: Hu
Applications: Flow, IHC-P, IF
NBP1-82045
Species: Hu
Applications: IHC, IHC-P
NB200-124
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, RIA
NBP1-91013
Species: Hu
Applications: WB, IHC, IHC-P
MAB25031
Species: Hu
Applications: WB, IHC, IP
NBP1-76514
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB600-1468
Species: Hu
Applications: WB, IHC-P, S-ELISA
NBP2-24566
Species: Hu
Applications: WB, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP1-31851
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-86406
Species: Hu
Applications: IHC, IHC-P

Publications for MUC3B Antibody (NBP1-70644) (0)

There are no publications for MUC3B Antibody (NBP1-70644).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MUC3B Antibody (NBP1-70644) (0)

There are no reviews for MUC3B Antibody (NBP1-70644). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MUC3B Antibody (NBP1-70644) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MUC3B Products

MUC3B NBP1-70644

Bioinformatics Tool for MUC3B Antibody (NBP1-70644)

Discover related pathways, diseases and genes to MUC3B Antibody (NBP1-70644). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MUC3B Antibody (NBP1-70644)

Discover more about diseases related to MUC3B Antibody (NBP1-70644).
 

Pathways for MUC3B Antibody (NBP1-70644)

View related products by pathway.

PTMs for MUC3B Antibody (NBP1-70644)

Learn more about PTMs related to MUC3B Antibody (NBP1-70644).

Blogs on MUC3B

There are no specific blogs for MUC3B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MUC3B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MUC3B