MUC17 Antibody

Images

 
Western Blot: MUC17 Antibody [NBP1-91013] - Analysis of AsPC-1 cell lysate (20ug loaded). Image from verified customer review.
Immunohistochemistry-Paraffin: MUC17 Antibody [NBP1-91013] - Staining of human small intestine shows moderate luminal membrane positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MUC17 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NPTSTPTVPRTTTCFGDGCQNTASRCKNGGTWDGLKCQCPNLYYGELCEEVVSSIDIGPPETISAQMELTVTVTSVKFTEELKNHSSQEFQEFKQTFTEQMNIVYSGIPEYVGVNITKLRLGSVVVEHDVLLRTKYTPEYK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MUC17
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. WB data from customer review.
Control Peptide
MUC17 Protein (NBP1-91013PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP1-91013 in the following applications:

Publications
Read Publications using
NBP1-91013 in the following applications:

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24533081)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MUC17 Antibody

  • membrane mucin MUC17
  • MUC-3
  • mucin 17, cell surface associated
  • secreted mucin MUC17
  • small intestinal mucin MUC3
  • small intestinal mucin-3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-11197
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-Fr, IHC-P
NB120-22711
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-52193
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-15196
Species: Hu, Mu, Rt, Po, Ch, Fe, Pm, Rb, Bv(-)
Applications: Flow, ICC/IF, IHC-Fr, IHC-P, Flow-IC
NBP1-92151
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-44374
Species: Hu
Applications: Flow, IHC-P, IF
NBP1-82045
Species: Hu
Applications: IHC, IHC-P
NB200-124
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, RIA
NBP2-44432
Species: Hu
Applications: Flow, IHC-P, PAGE, IF
MAB25031
Species: Hu
Applications: WB, IHC, IP
NBP1-76514
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB600-1468
Species: Hu
Applications: WB, IHC-P, S-ELISA
NBP2-24566
Species: Hu
Applications: WB, IHC-P
NBP1-31851
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP1-86406
Species: Hu
Applications: IHC, IHC-P
H00054474-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for MUC17 Antibody (NBP1-91013)(3)

Review for MUC17 Antibody (NBP1-91013) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.
We have 1 review tested in 1 application: WB.

Reviews using NBP1-91013:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot MUC17 NBP1-91013
Enlarge
reviewed by:
Ming Lu
WB Human 09/26/2014
View

Summary

ApplicationWestern Blot
Sample TestedHuman Pancreatic Cancer Cell line
SpeciesHuman
LotC78484
CommentsI was not sure if this antibody can be used in western since the protein is about 500kDa and the antibody was only tested in IHC. I tried native gel and 4-20% gel and saw bands at the correct molecular weight in both gels. So 5-Star, definitely!

Blocking

Blocking Details2% cold fish geletin in TBS buffer, room temperature for 1hour

Primary Anitbody

Dilution Ratio1:1000 overnight at 4C in blocking buffer

Secondary Antibody

Secondary DescriptionGoat anti-rabbit IgG, HRP
Secondary Manufacturer Cat#Cell Signaling, #7074
Secondary Concentration1:5000

Details

Detection Notes1 min exposure gives band at correct MW.

Comments

CommentsI was not sure if this antibody can be used in western since the protein is about 500kDa and the antibody was only tested in IHC. I tried native gel and 4-20% gel and saw bands at the correct molecular weight in both gels. So 5-Star, definitely!

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MUC17 Antibody (NBP1-91013) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MUC17 Products

MUC17 NBP1-91013

Bioinformatics Tool for MUC17 Antibody (NBP1-91013)

Discover related pathways, diseases and genes to MUC17 Antibody (NBP1-91013). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MUC17 Antibody (NBP1-91013)

Discover more about diseases related to MUC17 Antibody (NBP1-91013).
 

Pathways for MUC17 Antibody (NBP1-91013)

View related products by pathway.

PTMs for MUC17 Antibody (NBP1-91013)

Learn more about PTMs related to MUC17 Antibody (NBP1-91013).

Blogs on MUC17

There are no specific blogs for MUC17, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Ming Lu
09/26/2014
Application: WB
Species: Human

Bioinformatics

Gene Symbol MUC17