MUC12 Antibody - BSA Free

Immunohistochemistry-Paraffin: MUC12 Antibody [NBP1-82607] - Staining in human rectum and liver tissues using anti-MUC12 antibody. Corresponding MUC12 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: MUC12 Antibody [NBP1-82607] - Staining of human kidney shows no positivity in cells in tubules as expected.

Immunohistochemistry-Paraffin: MUC12 Antibody [NBP1-82607] - Staining of human rectum shows moderate positivity in luminal membrane of glandular cells.

Immunohistochemistry-Paraffin: MUC12 Antibody [NBP1-82607] - Staining of human liver shows low expression as expected.

Immunohistochemistry-Paraffin: MUC12 Antibody [NBP1-82607] - Staining of human colon shows moderate positivity in glandular cells of apical membrane.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MUC12 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MUC12 Antibody - BSA Free (NBP1-82607) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: EELFENLAEIVKAKIMNETRTTLLDPDSCRKAILCYSEEDTFVDSSVTPGFDFQEQCTQKAAEGYTQFYYVDVLDGKLACVNKCTKGTKSQMNCNLGTCQLQRSGPRCLCPNTNTHWYWG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MUC12
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  MUC12 Protein (NBP1-82607PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for MUC12 Antibody - BSA Free

• MUC11
• MUC-11
• MUC-12
• mucin 11
• mucin 12, cell surface associated
• mucin-11
• mucin-12

Background

Human MUC12 (Mucin 12) is a novel mucin of epithelial mucins, which are large, secreted or cell surface glycoproteins involved in epithelial cell protection, adhesion modulation, and signaling. Using differential display on RNA from paired normal colonic mucosa and primary colorectal tumor, MUC12 is identified as one of the 2 partial cDNAs representing novel mucin genes as well as MUC11. They are downregulated in colorectal tumors.The deduced MUC12 protein contains a predicted transmembrane domain, 2 extracellular cysteine-rich EGF-like domains, a coiled-coil region, and a domain consisting of serine-, threonine-, and proline-rich degenerate tandem repeats of 28 amino acids, a structural feature typical of mucins. Human MUC12 shares high sequence homology with MUC3 and MUC4 . Northern blot analysis of 50 different normal tissues detected MUC12 expression in colon, pancreas, prostate, and uterus, with highest expression in colon. The MUC12 transcript is large, estimated to be longer than 12 kb. Expression of MUC12 was downregulated or absent in 6 of 15 (40%) colorectal tumors, as compared with matched normal colonic tissues. MUC12 expression was not detected in any of 6 colorectal cancer cell lines examined. Epitheial mucins are secreted glycoproteins that play roles in cell protection, adhesion modulation and signaling. MUC 12 is a novel mucin gene and may be involved in epithelial cell growth regulation. MUC 12 is down-regulated in colorectal cancers.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MUC12