MUC12 Antibody

Images

 
Immunohistochemistry-Paraffin: MUC12 Antibody [NBP1-82607] - Staining of human rectum shows moderate positivity in luminal membrane of glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MUC12 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EELFENLAEIVKAKIMNETRTTLLDPDSCRKAILCYSEEDTFVDSSVTPGFDFQEQCTQKAAEGYTQFYYVDVLDGKLACVNKCTKGTKSQMNCNLGTCQLQRSGPRCLCPNTNTHWYWG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MUC12
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MUC12 Protein (NBP1-82607PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MUC12 Antibody

  • MUC11
  • MUC-11
  • MUC-12
  • mucin 11
  • mucin 12, cell surface associated
  • mucin-11
  • mucin-12

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-52193
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-44432
Species: Hu
Applications: Flow, IHC-P, PAGE, IF
NB120-22711
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-92151
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91013
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-44374
Species: Hu
Applications: Flow, IHC-P, IF
NBP2-15196
Species: Hu, Mu, Rt, Po, Ch, Fe, Pm, Rb, Bv(-)
Applications: Flow, ICC/IF, IHC-Fr, IHC-P, Flow-IC
NBP1-82045
Species: Hu
Applications: IHC, IHC-P
NB120-11197
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-Fr, IHC-P
NBP2-24566
Species: Hu
Applications: WB, IHC-P
NB600-1468
Species: Hu
Applications: WB, IHC-P, S-ELISA
NBP1-86406
Species: Hu
Applications: IHC, IHC-P
NBP1-76939
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-79720
Species: Hu
Applications: WB
MAB8245
Species: Hu
Applications: IHC
H00200958-P01
Species: Hu
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)

Publications for MUC12 Antibody (NBP1-82607) (0)

There are no publications for MUC12 Antibody (NBP1-82607).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MUC12 Antibody (NBP1-82607) (0)

There are no reviews for MUC12 Antibody (NBP1-82607). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MUC12 Antibody (NBP1-82607) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MUC12 Products

MUC12 NBP1-82607

Bioinformatics Tool for MUC12 Antibody (NBP1-82607)

Discover related pathways, diseases and genes to MUC12 Antibody (NBP1-82607). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MUC12 Antibody (NBP1-82607)

Discover more about diseases related to MUC12 Antibody (NBP1-82607).
 

Pathways for MUC12 Antibody (NBP1-82607)

View related products by pathway.

PTMs for MUC12 Antibody (NBP1-82607)

Learn more about PTMs related to MUC12 Antibody (NBP1-82607).
 

Research Areas for MUC12 Antibody (NBP1-82607)

Find related products by research area.

Blogs on MUC12

There are no specific blogs for MUC12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MUC12 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MUC12