MTMR15 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: MTMR15 Antibody [NBP2-56425] - Staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MTMR15 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MTMR15 Antibody - BSA Free (NBP2-56425) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RFTSLQQAQDLVSCLGGPVLSGVCRHLAADFRHCRGGLPDLVVWNSQSRHFKLVEVKGPNDRLSHKQMIWLAELQKLGAEVEVCHVVAVG
• Predicted Species: Mouse (92%), Rat (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FAN1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  MTMR15 Recombinant Protein Antigen (NBP2-56425PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for MTMR15 Antibody - BSA Free

• DKFZp451H236
• EC 3.1.21.-
• EC 3.1.4.1
• FANCD2/FANCI-associated nuclease 1DKFZp686K16147
• fanconi anemia associated nuclease 1
• fanconi-associated nuclease 1
• KIAA1018coiled-coil domain-containing protein MTMR15
• MTMR15
• myotubularin related protein 15
• Myotubularin-related protein 15

Background

The MTMR15 gene encodes a member of the myotubularin-related class 1 cysteine-based protein tyrosine phosphatases. The encoded protein may be catalytically inactive. Alternatively spliced transcript variants have been described. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FAN1