MTHFS Antibody

Images

 
Western Blot: MTHFS Antibody [NBP1-83161] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: Negative control (vector only transfected HEK293T lysate) Lane 3: Over-expression lysate (Co-expressed with a ...read more
Immunohistochemistry-Paraffin: MTHFS Antibody [NBP1-83161] - Staining of human liver shows strong nuclear and cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MTHFS Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VLPKTSWNIPQPGEGDVREEALSTGGLDLIFMPGLGFDKHGNRLGRGKGYYDAYLKRCLQHQEVKPYTLALAFKEQICLQVPVNENDMKVDEVLYEDSSTA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MTHFS
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MTHFS Protein (NBP1-83161PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MTHFS Antibody

  • 5,10-methenyltetrahydrofolate synthetase (5-formyltetrahydrofolatecyclo-ligase)
  • 5-formyltetrahydrofolate cyclo-ligase
  • EC 6.3.3.25,10-methenyl-tetrahydrofolate synthetase
  • FLJ30410
  • HsT19268
  • Methenyl-THF synthetase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34390
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP2-37607
Species: Hu, Rt
Applications: WB, ELISA, IHC
NBP2-32173
Species: Hu, Mu
Applications: WB, ELISA, IHC-P, IP
NB100-791
Species: Hu
Applications: WB, IHC, PEP-ELISA
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB200-616
Species: Hu, Mu
Applications: WB
NBP1-80754
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57749
Species: Hu
Applications: WB, IHC
NBP1-59904
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
H00000875-M01
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P, IP, RNAi
NBP2-57648
Species: Hu
Applications: WB, ICC/IF
NBP1-82612
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-25143
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF
NBP2-48965
Species: Hu
Applications: IHC
NB100-168
Species: Hu, Mu(-)
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, Flow-IC
H00010518-A01
Species: Hu, Ze
Applications: WB, ELISA
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP1-83161
Species: Hu
Applications: WB, IHC, IHC-P

Publications for MTHFS Antibody (NBP1-83161) (0)

There are no publications for MTHFS Antibody (NBP1-83161).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MTHFS Antibody (NBP1-83161) (0)

There are no reviews for MTHFS Antibody (NBP1-83161). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MTHFS Antibody (NBP1-83161) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MTHFS Products

Bioinformatics Tool for MTHFS Antibody (NBP1-83161)

Discover related pathways, diseases and genes to MTHFS Antibody (NBP1-83161). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MTHFS Antibody (NBP1-83161)

Discover more about diseases related to MTHFS Antibody (NBP1-83161).
 

Pathways for MTHFS Antibody (NBP1-83161)

View related products by pathway.

PTMs for MTHFS Antibody (NBP1-83161)

Learn more about PTMs related to MTHFS Antibody (NBP1-83161).

Blogs on MTHFS

There are no specific blogs for MTHFS, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MTHFS Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MTHFS