MTHFD1L Antibody - BSA Free

Western Blot: MTHFD1L Antibody [NBP2-57852] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.

Immunocytochemistry/Immunofluorescence: MTHFD1L Antibody [NBP2-57852] - Staining of human cell line MCF7 shows localization to mitochondria. Antibody staining is shown in green.

Simple Western: MTHFD1L Antibody [NBP2-57852] - Human U251 glioma cell line; whole cell lysate. Antibody at 1:250, 0.08 ug/uL total protein. Simple Western image submitted by a verified customer review.

• Reactivity: Hu
• Applications: WB, Simple Western, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MTHFD1L Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: HGSLEAALQCLFQRKGSMTMSIQWKTRQLQSKLHEADIVVLGSPKPEEIPLTWIQPGTTVLNCSHDFLSGKVGCGS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MTHFD1L
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25 - 2 ug/mL
  • Simple Western
  • Western Blot 0.04 - 0.4 ug/mL
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. This MTHFD1L Antibody is validated for Simple Western from a verified customer review.
  See Simple Western Antibody Database for Simple Western validation: Tested in Human U251 glioma cell line, whole cell lysate, separated by Size, antibody dilution of 1:250
• Control Peptide:

  MTHFD1L Recombinant Protein Antigen (NBP2-57852PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for MTHFD1L Antibody - BSA Free

• 10-formyl-THF synthetase
• dJ292B18.2
• DKFZp586G1517
• EC 6.3.4.3
• FLJ21145
• formyltetrahydrofolate synthetase domain containing 1
• Formyltetrahydrofolate synthetase
• FTHFSDC1
• methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1-like
• mitochondrial C1-tetrahydrofolate synthase
• mitochondrial C1-tetrahydrofolate synthetase
• monofunctional C1-tetrahydrofolate synthase, mitochondrial
• MTC1THFS

Background

MTHFD1L, also known as Monofunctional C1-tetrahydrofolate synthase, mitochondrial, consists of 2 a 978 amino acid isoform1 that is 106 kDa and a 275 amino acid isoform 2 that is 30 kDa; has mitochondrion subcellular location and highest expression found in placenta, thymus and brain; it is involved in the synthesis of tetrahydrofolate (THF) in the mitochondrion which is important in the de novo synthesis of purines and thymidylate and in the regeneration of methionine from homocysteine, and also may provide the missing metabolic reaction required to link the mitochondria and the cytoplasm in the mammalian model of one-carbon folate metabolism in embryonic an transformed cells complementing thus the enzymatic activities of MTHFD2. Current research is being performed on this protein involvement in cleft lip/palate, neural tube defect, homocysteine, coronary heart disease, chronic myeloid leukemia, Down syndrome, colon adenocarcinoma, nephropathy, Alzheimer's disease, dementia, colorectal cancer, leukemia, and atherosclerosis. This protein plays role in One carbon pool by folate and Metabolic pathways where it interacts with CASP4, MAGED1, WRAP73, WDR8, MAP1LC3A, and plus more than 40 other proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Review for MTHFD1L Antibody (NBP2-57852) (1)

Average Rating: 4

(Based on 1 review)

We have 1 review tested in 1 species: Human.

reviewed by: Verified Customer Simple Western Human 02/03/2020

Summary

• Application: Simple Western
• Sample Tested: U251 glioma cell line; whole cell lysate
• Species: Human
• Lot: R107310

Comments

• Comments: matériel: 1x25capillaires 12-230kDa Anticorps 1/250 Protéine : 0.08µg/µL ***Bio-Techne Response: This review was submitted through the legacy Novus Innovators Program, reflecting a new species or application tested on a primary antibody.***

Bioinformatics

• Gene Symbol: MTHFD1L