SLC19A3 Antibody


Western Blot: SLC19A3 Antibody [NBP1-69703] - Sample Tissue: Human Ovary Tumor Antibody Dilution: 1.0 ug/ml
Western Blot: SLC19A3 Antibody [NBP1-69703] - This Anti-SLC19A3 antibody was used in Western Blot of DU145 tissue lysate at a concentration of 1ug/ml.
Western Blot: SLC19A3 Antibody [NBP1-69703] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.
Western Blot: SLC19A3 Antibody [NBP1-69703] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.
Western Blot: SLC19A3 Antibody [NBP1-69703] - Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

SLC19A3 Antibody Summary

Synthetic peptides corresponding to SLC19A3(solute carrier family 19, member 3) The peptide sequence was selected from the middle region of SLC19A3 (NP_079519). Peptide sequence FATAGFNQVLNYVQILWDYKAPSQDSSIYNGAVEAIATFGGAVAAFAVGY.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.2-1 ug/ml
Theoretical MW
56 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Read Publication using
NBP1-69703 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
From PBS.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SLC19A3 Antibody

  • Solute carrier family 19 member 3
  • solute carrier family 19, member 3
  • thiamine transporter 2
  • THTR2
  • ThTr-2


SLC19A3 mediates high affinity thiamine uptake, propably via a proton anti-port mechanism. SLC19A3 has no folate transport activity.SLC19A3 is a member of the reduced folate family of micronutrient transporter genes.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IP, PLA
Species: Hu
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA
Species: Hu
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
Species: Hu
Applications: WB
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt, Po, Ce, Dr, In, Ma, Ye
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu
Applications: WB

Publications for SLC19A3 Antibody (NBP1-69703)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for SLC19A3 Antibody (NBP1-69703) (0)

There are no reviews for SLC19A3 Antibody (NBP1-69703). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC19A3 Antibody (NBP1-69703) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional SLC19A3 Products

Bioinformatics Tool for SLC19A3 Antibody (NBP1-69703)

Discover related pathways, diseases and genes to SLC19A3 Antibody (NBP1-69703). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC19A3 Antibody (NBP1-69703)

Discover more about diseases related to SLC19A3 Antibody (NBP1-69703).

Pathways for SLC19A3 Antibody (NBP1-69703)

View related products by pathway.

PTMs for SLC19A3 Antibody (NBP1-69703)

Learn more about PTMs related to SLC19A3 Antibody (NBP1-69703).

Blogs on SLC19A3

There are no specific blogs for SLC19A3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SLC19A3 Antibody and receive a gift card or discount.


Gene Symbol SLC19A3