MTCH2 Antibody

Images

 
Western Blot: MTCH2 Antibody [NBP1-54790] - Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MTCH2 Antibody Summary

Immunogen
Synthetic peptides corresponding to MTCH2(mitochondrial carrier homolog 2 (C. elegans)) The peptide sequence was selected from the N terminal of MTCH2. Peptide sequence ADAASQVLLGSGLTILSQPLMYVKVLIQVGYEPLPPTIGRNIFGRQVCQL.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MTCH2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against MTCH2 and was validated on Western blot.
Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MTCH2 Antibody

  • 2310034D24Rik
  • Met-induced mitochondrial protein
  • MIMP
  • mitochondrial carrier 2
  • mitochondrial carrier homolog 2 (C. elegans)
  • mitochondrial carrier homolog 2

Background

MTCH2 belongs to the mitochondrial carrier family. It contains 2 Solcar repeats. The substrate transported is not yet known. It induces mitochondrial depolarization.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-90558
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IF
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NBP2-14148
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5394
Species: Hu, Mu
Applications: WB
NB100-56106
Species: Hu, Mu, Rt, Ca, Ge
Applications: WB, IHC, IHC-Fr, IHC-P, IP
AF6915
Species: Hu, Mu, Rt
Applications: WB
NB110-60935
Species: Hu, Mu, Pm
Applications: WB
NBP1-76997
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP2-41103
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-92093
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14950
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24713
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, IHC-P
NB400-148
Species: Hu, Mu, Rt, Po, ChHa, Pm
Applications: WB, EM, ICC/IF, IHC, IHC-P
NBP2-24551
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB100-56092
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
AF5634
Species: Hu
Applications: WB
NB100-56104
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP1-54790
Species: Hu
Applications: WB

Publications for MTCH2 Antibody (NBP1-54790) (0)

There are no publications for MTCH2 Antibody (NBP1-54790).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MTCH2 Antibody (NBP1-54790) (0)

There are no reviews for MTCH2 Antibody (NBP1-54790). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MTCH2 Antibody (NBP1-54790) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MTCH2 Products

Bioinformatics Tool for MTCH2 Antibody (NBP1-54790)

Discover related pathways, diseases and genes to MTCH2 Antibody (NBP1-54790). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MTCH2 Antibody (NBP1-54790)

Discover more about diseases related to MTCH2 Antibody (NBP1-54790).
 

Pathways for MTCH2 Antibody (NBP1-54790)

View related products by pathway.

PTMs for MTCH2 Antibody (NBP1-54790)

Learn more about PTMs related to MTCH2 Antibody (NBP1-54790).

Blogs on MTCH2

There are no specific blogs for MTCH2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MTCH2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MTCH2
Uniprot