MRS2 Antibody (1E2) - Azide and BSA Free Summary
| Description |
Novus Biologicals Mouse MRS2 Antibody (1E2) - Azide and BSA Free (H00057380-M03) is a monoclonal antibody validated for use in ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
MRS2L (AAH01028, 1 a.a. ~ 117 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MECLRSLPCLLPRAMRLPRRTLCALALDVTSVGPPVAACGRRANLIGRSRAAQLCGPDRLRVAGEVHRFRTSDVSQATLASVAPVFTVTKFDKQGNVTSFVFESCDNSRVSSDIRLS |
| Specificity |
MRS2L - MRS2-like, magnesium homeostasis factor (S. cerevisiae) (1E2) |
| Isotype |
IgG2a Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
MRS2 |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA 1:100-1:2000
- Sandwich ELISA
|
| Application Notes |
This product is useful for ELISA. |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for MRS2 Antibody (1E2) - Azide and BSA Free
Background
Magnesium transporter that may mediate the influx of magnesium into the mitochondrial matrix
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: EnzAct
Species: Hu
Applications: ICC, IHC, IP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC-P, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Publications for MRS2 Antibody (H00057380-M03) (0)
There are no publications for MRS2 Antibody (H00057380-M03).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MRS2 Antibody (H00057380-M03) (0)
There are no reviews for MRS2 Antibody (H00057380-M03).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for MRS2 Antibody (H00057380-M03). (Showing 1 - 1 of 1 FAQ).
-
I would like to know, please, if you sell an Mrs2 (Magnesium Transporter) antibody to detect yeast Mrs2. i have seen you have a a couple of them for detection of human Mrs2. As the sequence identity between both species (yeast and human) is low, I am not sure if these antibodies would cross react.
- Currently we have two antibodies to MRS2. Unfortunately, neither has been tested for cross reaction with the yeast protein. I was also not able to find the yeast sequence to run alignments against our products. If you have this and would like me to run an alignment against our two products, I would be happy to do so. We typically like to see 80+% homology between sequences for ideal cross reaction, but we have seen much lower percentages yield positive results. Since this species would not be covered under our 100% guarantee, we can offer you our Innovators Reward Program if you decide to try one of our products. In exchange for a review of your experiment using one of our products, we would issue you a credit for the purchase price of the antibody for use in a future purchase.
Secondary Antibodies
| |
Isotype Controls
|
Additional MRS2 Products
Blogs on MRS2