MRPS30 Antibody

Images

 
Western Blot: MRPS30 Antibody [H00010884-B01P] - Analysis of MRPS30 expression in A-431.
Western Blot: MRPS30 Antibody [H00010884-B01P] - Analysis of MRPS30 expression in transfected 293T cell line by MRPS30 polyclonal antibody. Lane 1: MRPS30 transfected lysate(48.29 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

MRPS30 Antibody Summary

Immunogen
MRPS30 (NP_057724.2, 1 a.a. - 439 a.a.) full-length human protein. MAAARCWRPLLRGPRLSLHTAANAAATATETTCQDVAATPVARYPPIVASMTADSKAARLRRIERWQATVHAAESVDEKLRILTKMQFMKYMVYPQTFALNADRWYQYFTKTVFLSGLPPPPAEPEPEPEPEPEPALDLAALRAVACDCLLQEHFYLRRRRRVHRYEESEVISLPFLDQLVSTLVGLLSPHNPALAAAALDYRCPVHFYWVRGEEIIPRGHRRGRIDDLRYQIDDKPNNQIRISKQLAEFVPLDYSVPIEIPTIKCKPDKLPLFKRQYENHIFVGSKTADPCCYGHTQFHLLPDKLRRERLLRQNCADQIEVVFRANAIASLFAWTGAQAMYQGFWSEADVTRPFVSQAVITDGKYFSFFCYQLNTLALTTQADQNNPRKNICWGTQSKPLYETIEDNDVKGFNDDVLLQIVHFLLNRPKEEKSQLLEN
Specificity
MRPS30 - mitochondrial ribosomal protein S30,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
MRPS30
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
Application Notes
Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MRPS30 Antibody

  • 28S ribosomal protein S30, mitochondrial
  • DKFZp566B2024
  • mitochondrial ribosomal protein S30
  • MRP-S30
  • PAP
  • PDCD9
  • programmed cell death 9
  • Programmed cell death protein 9
  • S30mt

Background

Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that is similar to the chicken pro-apoptotic protein p52. Transcript variants using alternative promoters or polyA sites have been mentioned in the literature but the complete description of these sequences is not available. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13669
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00029968-A01
Species: Hu, Ba
Applications: WB, ELISA
AF4036
Species: Hu
Applications: WB, Simple Western
H00005324-M02
Species: Hu, Mu
Applications: WB, ChIP, ELISA, IHC, IHC-P
NBP2-27461
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
MAB25301
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-44520
Species: Hu, Ca(-), Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, Flow-IC, IF, MI
NBP1-92172
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-58268
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-48990
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-79286
Species: Rt
Applications: WB
NBP2-43686
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-19773
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-34594
Species: Hu, Pm
Applications: Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
AF4478
Species: Hu
Applications: WB, IHC
NBP2-67279
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for MRPS30 Antibody (H00010884-B01P) (0)

There are no publications for MRPS30 Antibody (H00010884-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MRPS30 Antibody (H00010884-B01P) (0)

There are no reviews for MRPS30 Antibody (H00010884-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MRPS30 Antibody (H00010884-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MRPS30 Products

Bioinformatics Tool for MRPS30 Antibody (H00010884-B01P)

Discover related pathways, diseases and genes to MRPS30 Antibody (H00010884-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MRPS30 Antibody (H00010884-B01P)

Discover more about diseases related to MRPS30 Antibody (H00010884-B01P).
 

Pathways for MRPS30 Antibody (H00010884-B01P)

View related products by pathway.

Research Areas for MRPS30 Antibody (H00010884-B01P)

Find related products by research area.

Blogs on MRPS30

There are no specific blogs for MRPS30, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MRPS30 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MRPS30
Entrez
Uniprot