MRPS11 Antibody - BSA Free Summary
Description |
Novus Biologicals Rabbit MRPS11 Antibody - BSA Free (NBP2-30823) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: SRFLRSWTWPQTAGRVVARTPAGTICTGARQLQDAAAKQKVEQNAAPSHTKFSIYPPIPGEESSLRWAGKKFEEIPIAHIKASHNNTQIQVVSASNEP |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
MRPS11 |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
- Western Blot 0.04-0.4 ug/ml
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for MRPS11 Antibody - BSA Free
Background
MRPS11, or Mitochondrial Ribosomal Protein S11, contains a 21 kDa, a 20 kDa, and a 17 kDa isoform, and is involved in protein synthesis within the 28S small subunit of the mitochondrial ribosome. Research is currently being done on the relationship between MRPS11 and a variety of diseases and disorders, including cervical cancer, mycobacterium tuberculosis, cervicitis, tuberculosis, and pneumonia. MRPS11 is linked to the response to DNA damage and the process of translation, and interacts with ICT1, MAP1LC3A, SLX4, MRPS2, and MRPS14.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), Neut, WB
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), Neut, WB
Species: Hu
Applications: BA, BA
Species: Hu
Applications: ELISA
Species: Hu
Applications: CyTOF-ready, Flow
Species: Hu
Applications: ELISA
Species: Mu
Applications: Neut, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut
Species: Mu
Applications: IHC, Neut, WB
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, Flow, ICC, Neut
Species: Mu
Applications: ELISA
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, Flow, IHC
Species: Mu
Applications: CyTOF-ready, Flow, ICC
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu
Applications: WB, ICC/IF, IHC
Publications for MRPS11 Antibody (NBP2-30823) (0)
There are no publications for MRPS11 Antibody (NBP2-30823).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MRPS11 Antibody (NBP2-30823) (0)
There are no reviews for MRPS11 Antibody (NBP2-30823).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for MRPS11 Antibody (NBP2-30823) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional MRPS11 Products
Blogs on MRPS11