FUNDC2 Antibody


Immunohistochemistry-Paraffin: FUNDC2 Antibody [NBP2-31745] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

FUNDC2 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: MAASSQGNFEGDIESVDLAEFAKQQPWWRKLFGPESGLSAEKYSVATHLFIG
Specificity of human FUNDC2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FUNDC2 Protein (NBP2-31745PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for FUNDC2 Antibody

  • cervical cancer oncogene 3
  • Cervical cancer proto-oncogene 3 protein
  • DC44
  • FLJ33773
  • FUN14 domain containing 2
  • FUN14 domain-containing protein 2
  • HCBP6MGC131676
  • HCC3
  • HCC-3
  • Hepatitis C virus core-binding protein 6
  • MGC2495
  • PD03104


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, KO
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: WB
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Mu
Applications: WB, Simple Western, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
Species: Hu
Applications: Flow, CyTOF-ready
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut

Publications for FUNDC2 Antibody (NBP2-31745) (0)

There are no publications for FUNDC2 Antibody (NBP2-31745).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FUNDC2 Antibody (NBP2-31745) (0)

There are no reviews for FUNDC2 Antibody (NBP2-31745). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for FUNDC2 Antibody (NBP2-31745) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional FUNDC2 Products

Bioinformatics Tool for FUNDC2 Antibody (NBP2-31745)

Discover related pathways, diseases and genes to FUNDC2 Antibody (NBP2-31745). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FUNDC2 Antibody (NBP2-31745)

Discover more about diseases related to FUNDC2 Antibody (NBP2-31745).

Pathways for FUNDC2 Antibody (NBP2-31745)

View related products by pathway.

Blogs on FUNDC2

There are no specific blogs for FUNDC2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our FUNDC2 Antibody and receive a gift card or discount.


Gene Symbol FUNDC2