MRPS11 Antibody - BSA Free

Western Blot: MRPS11 Antibody [NBP2-30548] - Analysis in control (vector only transfected HEK293T lysate) and MRPS11 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: MRPS11 Antibody [NBP2-30548] - Staining in human thyroid gland and pancreas tissues using anti-MRPS11 antibody. Corresponding MRPS11 RNA-seq data are presented for the same tissues.

Immunohistochemistry: MRPS11 Antibody [NBP2-30548] - Staining of human stomach, lower shows strong cytoplasmic and nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: MRPS11 Antibody [NBP2-30548] - Staining of human pancreas shows low expression as expected.

Immunohistochemistry-Paraffin: MRPS11 Antibody [NBP2-30548] - Staining of human thyroid gland shows high expression.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MRPS11 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MRPS11 Antibody - BSA Free (NBP2-30548) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: GFRNAKKGTGIAAQTAGIAAAARAKQKGVIHIRVVVKGLGPGRLSAMHGLIMGGLEVISITDNTPIPHNG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MRPS11
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  MRPS11 Protein (NBP2-30548PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (86%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for MRPS11 Antibody - BSA Free

• 28S ribosomal protein S11, mitochondrial
• Cervical cancer proto-oncogene 2 protein
• FLJ22512
• FLJ23406
• HCC-2S11mt
• mitochondrial ribosomal protein S11
• MRP-S11
• RPMS11

Background

MRPS11, or Mitochondrial Ribosomal Protein S11, contains a 21 kDa, a 20 kDa, and a 17 kDa isoform, and is involved in protein synthesis within the 28S small subunit of the mitochondrial ribosome. Research is currently being done on the relationship between MRPS11 and a variety of diseases and disorders, including cervical cancer, mycobacterium tuberculosis, cervicitis, tuberculosis, and pneumonia. MRPS11 is linked to the response to DNA damage and the process of translation, and interacts with ICT1, MAP1LC3A, SLX4, MRPS2, and MRPS14.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MRPS11
• Uniprot:
  • P82912(Human)