MRPS11 Antibody


Western Blot: MRPS11 Antibody [NBP2-30548] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate (Co-expressed with a more
Immunohistochemistry: MRPS11 Antibody [NBP2-30548] - Staining of human stomach, lower shows strong cytoplasmic and nuclear positivity in glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

MRPS11 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: GFRNAKKGTGIAAQTAGIAAAARAKQKGVIHIRVVVKGLGPGRLSAMHGLIMGGLEVISITDNTPIPHNG
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MRPS11 Protein (NBP2-30548PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (86%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for MRPS11 Antibody

  • 28S ribosomal protein S11, mitochondrial
  • Cervical cancer proto-oncogene 2 protein
  • FLJ22512
  • FLJ23406
  • HCC-2S11mt
  • mitochondrial ribosomal protein S11
  • MRP-S11
  • RPMS11


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
Species: Hu
Applications: WB, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), ICFlow, Neut, ELISA(Sta)
Species: Hu
Applications: Flow, CyTOF-ready
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
Species: Mu
Applications: WB, IHC, Neut
Species: Hu
Applications: Flow, CyTOF-ready, ICC, Neut
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Mu
Applications: Flow, CyTOF-ready, ICC
Species: Hu
Applications: WB, IHC, IHC-P

Publications for MRPS11 Antibody (NBP2-30548) (0)

There are no publications for MRPS11 Antibody (NBP2-30548).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MRPS11 Antibody (NBP2-30548) (0)

There are no reviews for MRPS11 Antibody (NBP2-30548). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MRPS11 Antibody (NBP2-30548) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional MRPS11 Products

Bioinformatics Tool for MRPS11 Antibody (NBP2-30548)

Discover related pathways, diseases and genes to MRPS11 Antibody (NBP2-30548). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MRPS11 Antibody (NBP2-30548)

Discover more about diseases related to MRPS11 Antibody (NBP2-30548).

Pathways for MRPS11 Antibody (NBP2-30548)

View related products by pathway.

Blogs on MRPS11

There are no specific blogs for MRPS11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MRPS11 Antibody and receive a gift card or discount.


Gene Symbol MRPS11