CORO1B Antibody - BSA Free

Western Blot: CORO1B Antibody [NBP2-49634] - Analysis in human cell lines MCF-7 and U-251MG using anti-CORO1B antibody. Corresponding CORO1B RNA-seq data are presented for the same cell lines. Loading control: anti-PPIB.

Immunohistochemistry-Paraffin: CORO1B Antibody [NBP2-49634] - Staining of human Prostate shows strong cytoplasmic positivity in glandular cells.

Western Blot: CORO1B Antibody [NBP2-49634] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251 MGLane 4: Human plasmaLane 5: Human Liver tissueLane 6: Human Tonsil tissue

Immunohistochemistry-Paraffin: CORO1B Antibody [NBP2-49634] - Staining of human colon shows moderate cytoplasmic and membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: CORO1B Antibody [NBP2-49634] - Staining of human prostate shows high expression.

Immunohistochemistry-Paraffin: CORO1B Antibody [NBP2-49634] - Staining of human skeletal muscle shows low expression as expected.

Immunohistochemistry-Paraffin: CORO1B Antibody [NBP2-49634] - Staining in human prostate and skeletal muscle tissues using anti-CORO1B antibody. Corresponding CORO1B RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: CORO1B Antibody [NBP2-49634] - Analysis in human prostate and skeletal muscle tissues using NBP2-49634 antibody. Corresponding CORO1B RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: CORO1B Antibody [NBP2-49634] - Staining of human Colon shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: CORO1B Antibody [NBP2-49634] - Staining of human Endometrium shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: CORO1B Antibody [NBP2-49634] - Staining of human Skeletal muscle shows no positivity in myocytes.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CORO1B Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: AYVPSKQRDLKISRRNVLSDSRPAMAPGSSHLGAPASTTTAAGATPSGSLARAGEAGKLEEVMQELRALRALVKEQGDRICRLEEQLGRMENGD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CORO1B
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 1:100 - 1:250
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  CORO1B Recombinant Protein Antigen (NBP2-49634PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CORO1B Antibody - BSA Free

• coronin, actin binding protein, 1B
• coronin, actin-binding protein, 1B
• coronin-1B
• coronin-2
• DKFZp762I166

Background

Coronin 2 is an F-actin binding protein that plays an important role in processes involving actin dynamics such as fibroblast migration, and phagocytosis. Coronin 2 influences actin dynamics by promoting actin depolymerization. It has been shown to interact with the Arp2/3 complex and inhibit Arp2/3-induced actin nucleation. Additionally, it can regulate motility by regulating the actin severing and disassembling activity of cofilin.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CORO1B