DNAJC19 Antibody


Immunohistochemistry: DNAJC19 Antibody [NBP1-87346] - Staining of human kidney shows strong cytoplasmic and extracellular positivity in tubule cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P

Order Details

DNAJC19 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: LQAMKHMEPQVKQVFQSLPKSAFSGGYYRGGFEPK
Predicted Species
Mouse (94%), Rat (97%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
DNAJC19 Protein (NBP1-87346PEP)
Reviewed Applications
Read 1 Review rated 5
NBP1-87346 in the following applications:

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for DNAJC19 Antibody

  • DnaJ (Hsp40) homolog, subfamily C, member 19
  • DnaJ homolog subfamily C member 19
  • homolog of yeast TIM14
  • mitochondrial import inner membrane translocase subunit TIM14
  • Tim14
  • TIMM14TIM14Pam18


Probable component of the PAM complex, a complex required for the translocation of transit peptide-containingproteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. May act as a co-chaperonethat stimulate the ATP-dependent activity


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IP (-), WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC, Simple Western, WB
Species: Bv, Ca, Ch, Gp, Ha, Hu, Mu, Md, Po, Pm, Rb, Rt, Sh, Xp
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IP, WB
Species: Hu
Applications: WB
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA

Publications for DNAJC19 Antibody (NBP1-87346) (0)

There are no publications for DNAJC19 Antibody (NBP1-87346).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for DNAJC19 Antibody (NBP1-87346) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using NBP1-87346:
Filter by Applications
All Applications
Filter by Species
All Species
Images Ratings Applications Species Date Details
Western Blot DNAJC19 NBP1-87346
reviewed by:
Shijun Yan
WB Mouse 08/02/2016


ApplicationWestern Blot
Sample TestedMitochondria fractions (membrane and matrix) from mouse brain

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for DNAJC19 Antibody (NBP1-87346) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional DNAJC19 Products

Bioinformatics Tool for DNAJC19 Antibody (NBP1-87346)

Discover related pathways, diseases and genes to DNAJC19 Antibody (NBP1-87346). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DNAJC19 Antibody (NBP1-87346)

Discover more about diseases related to DNAJC19 Antibody (NBP1-87346).

Pathways for DNAJC19 Antibody (NBP1-87346)

View related products by pathway.

Research Areas for DNAJC19 Antibody (NBP1-87346)

Find related products by research area.

Blogs on DNAJC19

There are no specific blogs for DNAJC19, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Recent Reviews


Shijun Yan
Application: WB
Species: Mouse


Gene Symbol DNAJC19