DNAJC19 Antibody

Images

 
Immunohistochemistry: DNAJC19 Antibody [NBP1-87346] - Staining of human kidney shows strong cytoplasmic and extracellular positivity in tubule cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DNAJC19 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LQAMKHMEPQVKQVFQSLPKSAFSGGYYRGGFEPK
Specificity
Specificity of human DNAJC19 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DNAJC19
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Reviewed Applications
Read 1 Review rated 5
using
NBP1-87346 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DNAJC19 Antibody

  • DnaJ (Hsp40) homolog, subfamily C, member 19
  • DnaJ homolog subfamily C member 19
  • homolog of yeast TIM14
  • mitochondrial import inner membrane translocase subunit TIM14
  • Tim14
  • TIMM14TIM14Pam18

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-98528
Species: Hu
Applications: WB
NBP1-86941
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-67817
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-97841
Species: Hu
Applications: IP (-), WB
NBP2-34075
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80681
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-131
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO
NBP1-92298
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-66897
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-97503
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, GP, Ha, Md, Pm, Rb, Sh, Xp
Applications: WB, IHC, IHC-P, IP
NBP1-80525
Species: Mu
Applications: WB
NBP2-38791
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1607
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
PP-H7431-00
Species: Hu
Applications: WB
NBP1-80680
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-92509
Species: Hu
Applications: WB, IHC, IHC-P
7954-GM/CF
Species: Hu
NBP1-87346
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for DNAJC19 Antibody (NBP1-87346) (0)

There are no publications for DNAJC19 Antibody (NBP1-87346).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for DNAJC19 Antibody (NBP1-87346) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using NBP1-87346:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot DNAJC19 NBP1-87346
Enlarge
reviewed by:
Anonymous
WB Mouse 08/02/2016
View

Summary

ApplicationWestern Blot
Sample TestedMitochondria fractions (membrane and matrix) from mouse brain
SpeciesMouse

Blocking

Blocking Details2% non fat milk

Primary Anitbody

Dilution Ratioovernight, 4 degree, 1:2000 in PBST

Secondary Antibody

Secondary DescriptionGoat anti-rabbit IgG
Secondary Concentration1:5000

Details

Detection Noteswestern blot, exposure time 5-10 sec

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for DNAJC19 Antibody (NBP1-87346) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional DNAJC19 Products

Bioinformatics Tool for DNAJC19 Antibody (NBP1-87346)

Discover related pathways, diseases and genes to DNAJC19 Antibody (NBP1-87346). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DNAJC19 Antibody (NBP1-87346)

Discover more about diseases related to DNAJC19 Antibody (NBP1-87346).
 

Pathways for DNAJC19 Antibody (NBP1-87346)

View related products by pathway.

Research Areas for DNAJC19 Antibody (NBP1-87346)

Find related products by research area.

Blogs on DNAJC19

There are no specific blogs for DNAJC19, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Anonymous
08/02/2016
Application: WB
Species: Mouse

Bioinformatics

Gene Symbol DNAJC19
Novus 100% Guarantee