MPP1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: MPP1 Antibody [NBP2-55110] - Staining of human cell line A-431 shows localization to nuclear speckles.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MPP1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TEEMTRNISANEFLEFGSYQGNMFGTKFETVHQIHKQNKIAILDIEPQTLKIVRTAELSPFIVFIAPTDQGTQTEALQQLQKDSEAIRSQYAHYFDLSLVNNGVDETLKKLQEAFDQACSS
Specificity
Specificity of human MPP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MPP1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MPP1 Recombinant Protein Antigen (NBP2-55110PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for MPP1 Antibody

  • 55 kDa erythrocyte membrane protein
  • AAG12
  • EC 2.7.11
  • Membrane protein, palmitoylated 1
  • membrane protein, palmitoylated 1, 55kDa
  • MRG1
  • palmitoylated erythrocyte membrane protein
  • PEMPpalmitoylated 1 (55kD)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB224
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB110-40561
Species: Hu
Applications: WB, IP
NBP1-18910
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF5789
Species: Hu, Mu, Rt
Applications: WB
AF1138
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP1-84550
Species: Hu
Applications: WB, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
7270-IL/CF
Species: Hu
6507-IL/CF
Species: Hu
NBP1-49833
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-33736
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MPP1 Antibody (NBP2-55110) (0)

There are no publications for MPP1 Antibody (NBP2-55110).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MPP1 Antibody (NBP2-55110) (0)

There are no reviews for MPP1 Antibody (NBP2-55110). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MPP1 Antibody (NBP2-55110) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for MPP1 Antibody (NBP2-55110)

Discover related pathways, diseases and genes to MPP1 Antibody (NBP2-55110). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MPP1 Antibody (NBP2-55110)

Discover more about diseases related to MPP1 Antibody (NBP2-55110).
 

Pathways for MPP1 Antibody (NBP2-55110)

View related products by pathway.

PTMs for MPP1 Antibody (NBP2-55110)

Learn more about PTMs related to MPP1 Antibody (NBP2-55110).
 

Research Areas for MPP1 Antibody (NBP2-55110)

Find related products by research area.

Blogs on MPP1

There are no specific blogs for MPP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MPP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MPP1