MPG Antibody (4B12)

Images

 
Western Blot: MPG Antibody (4B12) [H00004350-M08] - Analysis of MPG expression in Hela S3 NE (Cat # L013V3).
Immunocytochemistry/ Immunofluorescence: MPG Antibody (4B12) [H00004350-M08] - Analysis of monoclonal antibody to MPG on HeLa cell. Antibody concentration 10 ug/ml
Sandwich ELISA: MPG Antibody (4B12) [H00004350-M08] - Detection limit for recombinant GST tagged MPG is approximately 10ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
4B12
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

MPG Antibody (4B12) Summary

Immunogen
MPG (AAH14991, 1 a.a. - 90 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPARSGAQFCRRMGQKKQRPARAGQPHSSSDAAQAPAEQPHSSSDAAQAPCPRERCLGPPTTPGPYRSIYFSSPKGHLTRLGLEFFDQPA
Specificity
MPG - N-methylpurine-DNA glycosylase
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MPG
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MPG Antibody (4B12)

  • 3' end of the Mid1 gene, localized 68 kb upstream the humanzeta globin gene on16p
  • 3-alkyladenine DNA glycosylase
  • 3-methyladenine DNA glycosidase
  • AAG
  • ADPG
  • anpg
  • APNG
  • CRA36.1 (3-methyl-adenine DNA glycosylase)
  • CRA36.1
  • DNA-3-methyladenine glycosylase
  • EC 3.2.2.21
  • MDGalkyladenine DNA glycosylase
  • Mid1
  • N-methylpurine-DNA glycosylase, MPG
  • N-methylpurine-DNA glycosylasePIG16
  • PIG11
  • proliferation-inducing protein 11
  • proliferation-inducing protein 16

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-116
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA
NB100-168
Species: Hu, Mu(-)
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, Flow-IC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-45897
Species: Hu
Applications: WB, IHC
NB100-858
Species: Hu, Mu, Rt, GP, Mk
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IHC-WhMt
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-16182
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
H00008086-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
H00005018-D01P
Species: Hu
Applications: WB, ICC/IF
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP1-88866
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-106
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB600-935
Species: Bv
Applications: WB, ELISA, IP
H00004350-M08
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for MPG Antibody (H00004350-M08) (0)

There are no publications for MPG Antibody (H00004350-M08).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MPG Antibody (H00004350-M08) (0)

There are no reviews for MPG Antibody (H00004350-M08). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MPG Antibody (H00004350-M08) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MPG Products

Bioinformatics Tool for MPG Antibody (H00004350-M08)

Discover related pathways, diseases and genes to MPG Antibody (H00004350-M08). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MPG Antibody (H00004350-M08)

Discover more about diseases related to MPG Antibody (H00004350-M08).
 

Pathways for MPG Antibody (H00004350-M08)

View related products by pathway.

PTMs for MPG Antibody (H00004350-M08)

Learn more about PTMs related to MPG Antibody (H00004350-M08).

Blogs on MPG

There are no specific blogs for MPG, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MPG Antibody (4B12) and receive a gift card or discount.

Bioinformatics

Gene Symbol MPG
Entrez
OMIM
Uniprot