MOSPD2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: MOSPD2 Antibody [NBP1-93499] - Staining of human cell line A-431 shows localization to endoplasmic reticulum. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: MOSPD2 Antibody [NBP1-93499] - Staining of human lung shows moderate cytoplasmic positivity in macrophages.

Immunohistochemistry-Paraffin: MOSPD2 Antibody [NBP1-93499] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

ELISA: MOSPD2 Antibody [NBP1-93499] - ELISA image submitted by a verified customer review.

Western Blot-MOSPD2 Antibody [NBP1-93499] - Analysis in human cell lines SK-MEL-30 and MCF-7 using Anti-MOSPD2 antibody. Corresponding MOSPD2 RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1.

Staining of human cerebral cortex shows strong cytoplasmic positivity in a subset of glial cells.

Staining of human liver shows weak cytoplasmic positivity in Kupffer cells.

Staining of human placenta shows moderate cytoplasmic positivity in a subset of leukocytes.

Analysis in human cell lines SK-MEL-30 and MCF-7 using Anti-MOSPD2 antibody. Corresponding MOSPD2 RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1.

Staining of human skeletal muscle shows no positivity in myocytes as expected.

Staining of human lung shows moderate cytoplasmic positivity in macrophages.

• Reactivity: Hu, Pm, Rt
• Applications: ELISA, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MOSPD2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MOSPD2 Antibody - BSA Free (NBP1-93499) is a polyclonal antibody validated for use in IHC, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SSKEDIESDGKETLETISNEEQTPLLKKINPTESTSKAEENEKVDSKVKAFKKPLSVFKGPLLHISPAEELYFGSTESGEKKTLIVLTNVTKNIVAFKVRTTAPEKYRVKPSNSSCDPGASVDIVVSPHGGLTVSA
• Predicted Species: Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MOSPD2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Validated from a verified customer review
  • Immunocytochemistry/ Immunofluorescence 0.25 - 2 ug/mL
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  MOSPD2 Protein (NBP1-93499PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%). Primate reactivity reported from a verified customer review.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2), 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for MOSPD2 Antibody - BSA Free

• DKFZp686C1553
• MGC26706
• motile sperm domain containing 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Review for MOSPD2 Antibody (NBP1-93499) (1)

Average Rating: 5

(Based on 1 review)

We have 1 review tested in 1 species: Monkey.

reviewed by: Vijay Patel ELISA Monkey 12/12/2020

Summary

• Application: ELISA
• Sample Tested: Serum
• Species: Monkey
• Lot: C119204

Bioinformatics

• Gene Symbol: MOSPD2