OTOP1 Antibody

Images

 
Immunohistochemistry-Paraffin: OTOP1 Antibody [NBP1-86306] - Staining of human duodenum shows moderate cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

OTOP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NGVLNESKHQLNEHKEWLITLGFGNITTVLDDHTPQCNCTPPTLCTAISHGI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
OTOP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
OTOP1 Protein (NBP1-86306PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%), Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for OTOP1 Antibody

  • MGC163302
  • MGC163304
  • otopetrin 1
  • otopetrin-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-30867
Species: Hu
Applications: IHC, IHC-P
NBP2-56316
Species: Hu
Applications: IHC, IHC-P
NBP1-89076
Species: Hu
Applications: IHC, IHC-P
NBP2-52911
Species: Hu
Applications: WB, IHC, IHC-P
NB100-2593
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-87382
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-38132
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-21021
Species: Hu
Applications: WB, ICC/IF
NBP1-86380
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56703
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NB600-1438
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IP
NBP1-21502
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-84897
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP1-93499
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF2605
Species: Hu
Applications: WB, Simple Western, IHC, ICC

Publications for OTOP1 Antibody (NBP1-86306) (0)

There are no publications for OTOP1 Antibody (NBP1-86306).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OTOP1 Antibody (NBP1-86306) (0)

There are no reviews for OTOP1 Antibody (NBP1-86306). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for OTOP1 Antibody (NBP1-86306) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional OTOP1 Products

OTOP1 NBP1-86306

Bioinformatics Tool for OTOP1 Antibody (NBP1-86306)

Discover related pathways, diseases and genes to OTOP1 Antibody (NBP1-86306). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for OTOP1 Antibody (NBP1-86306)

Discover more about diseases related to OTOP1 Antibody (NBP1-86306).
 

Pathways for OTOP1 Antibody (NBP1-86306)

View related products by pathway.

Blogs on OTOP1

There are no specific blogs for OTOP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our OTOP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol OTOP1