MOSPD3 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: MOSPD3 Antibody [NBP1-85698] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: MOSPD3 Antibody [NBP1-85698] -Staining of human skin shows strong nuclear positivity in squamous epithelial cells.

Immunohistochemistry-Paraffin: MOSPD3 Antibody [NBP1-85698] - Staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: MOSPD3 Antibody [NBP1-85698] - Staining of human kidney shows moderate nuclear positivity in cells in tubules and cells in glomeruli.

Immunohistochemistry-Paraffin: MOSPD3 Antibody [NBP1-85698] - Staining of human colon shows moderate nuclear positivity in glandular cells.

Analysis in control (vector only transfected HEK293T lysate) and MOSPD3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MOSPD3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MOSPD3 Antibody - BSA Free (NBP1-85698) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: QSCIDIVIRHVAPIPSHYDVQDRFRIELSEEGAEGRVVGRKDITSILRAPAYPLELQGQPDPAPRP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MOSPD3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  MOSPD3 Protein (NBP1-85698PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%), Rat (89%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for MOSPD3 Antibody - BSA Free

• CDS3
• motile sperm domain containing 3
• motile sperm domain-containing protein 3
• NET30

Background

MOSPD3, also known as Motile sperm domain-containing protein 3, has 4 isoforms, a 235 amino acid isoform that is 26 kDa, a 221 amino acid isoform that is 24 kDa, a 182 amino acid isoform that is 20 kDa, and a 225 amino acid isoform that 24 kDa. Little is currently known about MOSPD3 disease involvement. This protein has been linked to heart development process.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MOSPD3