Cyclin T2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Cyclin T2 Antibody [NBP1-87592] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm, plasma membrane & cytosol.
Immunohistochemistry-Paraffin: Cyclin T2 Antibody [NBP1-87592] - Staining of human duodenum shows strong nuclear positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Cyclin T2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KAGSSKHHGPISTTPGIIPQKMSLDKYREKRKLETLDLDVRDHYIAAQVEQQHKQGQSQAASSSSVTSPIKMKIPIANTEKYMADKKEKSGSLKLRIPIPPTDKSASKEELKMKIKVSSSERHSSSDEGSGKSKHSSPH
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CCNT2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Cyclin T2 Protein (NBP1-87592PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP1-87592 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Cyclin T2 Antibody

  • cyclin T2
  • cyclin T2a
  • cyclin T2b
  • cyclin-T2
  • CYCT2
  • FLJ13583
  • FLJ90560
  • MGC134840
  • SDS-stable vimentin-bound DNA fragment HEF42VIM22
  • subunit of positive elongation transcription factor b

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-10874
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
H00000904-Q01
Species: Hu
NB100-56511
Species: Hu, Mu, Rt, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
46420002
Species: Hu
Applications: WB, ELISA
NBP2-48990
Species: Hu
Applications: ICC/IF, IHC
NBP1-06519
Species: Hu
Applications: WB, IHC-P, IP
NBP1-88376
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-71867
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NB100-56510
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-89285
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56762
Species: Hu
Applications: WB, ICC/IF
H00004188-M07
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-56159
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-87592
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for Cyclin T2 Antibody (NBP1-87592) (0)

There are no publications for Cyclin T2 Antibody (NBP1-87592).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for Cyclin T2 Antibody (NBP1-87592) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Mouse and Human.
We have 1 review tested in 1 application: WB.

Reviews using NBP1-87592:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Mouse and Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot Cyclin T2 NBP1-87592
Enlarge
reviewed by:
Anonymous
WB Mouse and Human 12/02/2016
View

Summary

ApplicationWestern Blot
Sample TestedHEK 293 cell lysate
SpeciesMouse and Human
LotA08480

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Cyclin T2 Antibody (NBP1-87592) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cyclin T2 Products

Bioinformatics Tool for Cyclin T2 Antibody (NBP1-87592)

Discover related pathways, diseases and genes to Cyclin T2 Antibody (NBP1-87592). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cyclin T2 Antibody (NBP1-87592)

Discover more about diseases related to Cyclin T2 Antibody (NBP1-87592).
 

Pathways for Cyclin T2 Antibody (NBP1-87592)

View related products by pathway.

PTMs for Cyclin T2 Antibody (NBP1-87592)

Learn more about PTMs related to Cyclin T2 Antibody (NBP1-87592).
 

Research Areas for Cyclin T2 Antibody (NBP1-87592)

Find related products by research area.

Blogs on Cyclin T2

There are no specific blogs for Cyclin T2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Anonymous
12/02/2016
Application: WB
Species: Mouse and Human

Bioinformatics

Gene Symbol CCNT2