MOBP Antibody (4C2) - Azide and BSA Free

Western Blot: MOBP Antibody (4C2) [H00004336-M08] - Analysis of MOBP expression in transfected 293T cell line by MOBP monoclonal antibody (M08), clone 4C2. Lane 1: MOBP transfected lysatE (9.6 KDa). Lane 2: Non-transfected lysate.

ELISA: MOBP Antibody (4C2) [H00004336-M08] - Detection limit for recombinant GST tagged MOBP is 0.3 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 4C2
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

MOBP Antibody (4C2) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: MOBP (AAH22471, 1 a.a. ~ 81 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSQKPAKEGPRLSKNQKYSEHFSIHCCPPFTFLNSKKEIVDRKYSICKSGCFYQKKEEDWICCACQKTRLKRKIRPTPKKK
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: MOBP
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: It has been used for ELISA and WB.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MOBP Antibody (4C2) - Azide and BSA Free

• MGC87379
• myelin-associated oligodendrocyte basic protein

Background

MOBP may play a role in compacting or stabilizing the myelin sheath, possibly by binding the negatively chargedacidic phospholipids of the cytoplasmic membrane

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MOBP
• Uniprot:
  • AAH22471(Human)