MOBP Antibody (4C2)


Western Blot: MOBP Antibody (4C2) [H00004336-M08] - Analysis of MOBP expression in transfected 293T cell line by MOBP monoclonal antibody (M08), clone 4C2. Lane 1: MOBP transfected lysatE (9.6 KDa). Lane 2: more
ELISA: MOBP Antibody (4C2) [H00004336-M08] - Detection limit for recombinant GST tagged MOBP is 0.3 ng/ml as a capture antibody.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ELISA

Order Details

MOBP Antibody (4C2) Summary

MOBP (AAH22471, 1 a.a. - 81 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSQKPAKEGPRLSKNQKYSEHFSIHCCPPFTFLNSKKEIVDRKYSICKSGCFYQKKEEDWICCACQKTRLKRKIRPTPKKK
IgG1 Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
PBS (pH 7.4)
No Preservative
IgG purified


Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MOBP Antibody (4C2)

  • MGC87379
  • myelin-associated oligodendrocyte basic protein


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Rt
Applications: WB
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, ChIP, ICC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Mu
Applications: WB
Species: Hu
Applications: WB, ELISA

Publications for MOBP Antibody (H00004336-M08) (0)

There are no publications for MOBP Antibody (H00004336-M08).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MOBP Antibody (H00004336-M08) (0)

There are no reviews for MOBP Antibody (H00004336-M08). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MOBP Antibody (H00004336-M08) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional MOBP Products

Bioinformatics Tool for MOBP Antibody (H00004336-M08)

Discover related pathways, diseases and genes to MOBP Antibody (H00004336-M08). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MOBP Antibody (H00004336-M08)

Discover more about diseases related to MOBP Antibody (H00004336-M08).

Pathways for MOBP Antibody (H00004336-M08)

View related products by pathway.

PTMs for MOBP Antibody (H00004336-M08)

Learn more about PTMs related to MOBP Antibody (H00004336-M08).

Research Areas for MOBP Antibody (H00004336-M08)

Find related products by research area.

Blogs on MOBP

There are no specific blogs for MOBP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MOBP Antibody (4C2) and receive a gift card or discount.


Gene Symbol MOBP