MMRN1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: MMRN1 Antibody [NBP1-84014] - Staining of human cell line HUVEC TERT2 shows localization to endoplasmic reticulum.
Immunohistochemistry-Paraffin: MMRN1 Antibody [NBP1-84014] - staining of human vulva/anal skin shows strong cytoplasmic positivity in squamous epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MMRN1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RHNLLRNEVQGRDDALERRINEYALEMEDGLNKTMTIINNAIDFIQDNYALKETLSTIKDNSEIHHKCTSDMETILTFIPQFHRLND
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MMRN1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MMRN1 Protein (NBP1-84014PEP)
Publications
Read Publication using
NBP1-84014 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MMRN1 Antibody

  • ECMmultimerin
  • Elastin microfibril interface located protein 4
  • Elastin microfibril interfacer 4
  • EMILIN-4
  • EMILIN4GPIa*
  • Endothelial cell multimerin
  • glycoprotein Ia*
  • GPIA*
  • MMRN
  • multimerin 1
  • multimerin-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-26380
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88527
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88526
Species: Hu
Applications: WB, IHC, IHC-P
NB600-586
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF5745
Species: Hu
Applications: WB, IHC
NBP1-33320
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84127
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-30584
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88114
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-81858
Species: Hu
Applications: WB, IHC, IHC-P
AF1219
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, CyTOF-ready, ICC
NBP1-89441
Species: Hu
Applications: ICC/IF, IHC, IHC-P, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP2-03256
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-83977
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB300-119
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-84014
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for MMRN1 Antibody (NBP1-84014)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: ICC/IF.


Filter By Application
ICC/IF
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for MMRN1 Antibody (NBP1-84014) (0)

There are no reviews for MMRN1 Antibody (NBP1-84014). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MMRN1 Antibody (NBP1-84014) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MMRN1 Products

Bioinformatics Tool for MMRN1 Antibody (NBP1-84014)

Discover related pathways, diseases and genes to MMRN1 Antibody (NBP1-84014). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MMRN1 Antibody (NBP1-84014)

Discover more about diseases related to MMRN1 Antibody (NBP1-84014).
 

Pathways for MMRN1 Antibody (NBP1-84014)

View related products by pathway.

PTMs for MMRN1 Antibody (NBP1-84014)

Learn more about PTMs related to MMRN1 Antibody (NBP1-84014).

Blogs on MMRN1

There are no specific blogs for MMRN1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MMRN1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MMRN1