MMRN2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: MMRN2 Antibody [NBP1-83977] - Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.
Immunohistochemistry-Paraffin: MMRN2 Antibody [NBP1-83977] - Staining of human duodenum shows strong cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MMRN2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:HAQHFTLHRSISELQADVDTKLKRLHKAQEAPGTNGSLVLATPGAGARPEPDSLQARLGQLQRNLSELHMTTARREEELQYTLEDMRATLTRHVDEIKELYSESDETFDQISKVERQVEELQVNHTALRELRVILMEK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MMRN2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MMRN2 Protein (NBP1-83977PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MMRN2 Antibody

  • Elastin microfibril interface located protein 3
  • Elastin microfibril interfacer 3EMILIN-3
  • EMILIN3
  • EMILIN-like protein EndoGlyx-1
  • EndoGlyx-1 p125/p140 subunit
  • EndoGlyx-1
  • FLJ13465
  • multimerin 2
  • multimerin-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84127
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-77310
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NB100-2076
Species: Hu, Po, Ca, Fe, Gt, GP, Sh
Applications: WB, IHC, IHC-P
AF2065
Species: Mu
Applications: WB, Simple Western, ICC
AF644
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP2-36064
Species: Hu
Applications: WB, IHC-Fr
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-59788
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88840
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-03414
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00002191-M01
Species: Hu
Applications: WB, ELISA, IP

Publications for MMRN2 Antibody (NBP1-83977) (0)

There are no publications for MMRN2 Antibody (NBP1-83977).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MMRN2 Antibody (NBP1-83977) (0)

There are no reviews for MMRN2 Antibody (NBP1-83977). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MMRN2 Antibody (NBP1-83977) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MMRN2 Products

Bioinformatics Tool for MMRN2 Antibody (NBP1-83977)

Discover related pathways, diseases and genes to MMRN2 Antibody (NBP1-83977). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MMRN2 Antibody (NBP1-83977)

Discover more about diseases related to MMRN2 Antibody (NBP1-83977).
 

Pathways for MMRN2 Antibody (NBP1-83977)

View related products by pathway.

Blogs on MMRN2

There are no specific blogs for MMRN2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MMRN2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MMRN2