EMILIN1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: EMILIN1 Antibody [NBP1-84127] - Human periodontal ligament cells stained with anti-emilin1 (1:300) and goat anti-rabbit Alexa Fluor 488 (1:500). Nuclei costained with 300nM DAPI. ICC/IF image submitted by a verified customer review.

Immunohistochemistry-Paraffin: EMILIN1 Antibody [NBP1-84127] - 5 um section of formalin-fixed paraffin-embedded rat nasal concha stained with anti-emilin1 (1:300) and goat anti-rabbit Alexa Fluor 488 (1:500) and DAPI (300 nM). IHC-P image submitted by a verified customer review.

Immunohistochemistry-Paraffin: EMILIN1 Antibody [NBP1-84127] - Staining of human prostate shows strong membranous positivity in smooth muscle cells.

Immunohistochemistry-Paraffin: EMILIN1 Antibody [NBP1-84127] - Staining of human skin shows strong positivity in connective tissue.

Immunohistochemistry-Paraffin: EMILIN1 Antibody [NBP1-84127] - Staining of human testis shows moderate membranous positivity in peritubular myoid cells.

Immunohistochemistry-Paraffin: EMILIN1 Antibody [NBP1-84127] - Staining of human cerebral cortex shows no positivity in neurons as expected.

Analysis in human cell line SH-SY5Y.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

EMILIN1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit EMILIN1 Antibody - BSA Free (NBP1-84127) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-EMILIN1 Antibody: Cited in 5 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PQSIMYRRFLRPRYRVAYKTVTDMEWRCCQGYGGDDCAESPAPALGPASSTPRPLARPARPNLSGSSAGSPLSGLGGEGPGESEKVQQLEEQVQSLTKELQGLRGVLQGLSGRLAEDVQRAVETAFNGRQQPADAAARPGVHETLNE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EMILIN1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence Validated from a verified customer review.
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04 - 0.4 ug/mL
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  EMILIN1 Recombinant Protein Antigen (NBP1-84127PEP)

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 23637335). Rat reactivity reported from a verified customer review.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for EMILIN1 Antibody - BSA Free

• DKFZp586M121
• elastin microfibril interface-located protein 1
• elastin microfibril interfacer 1
• EMI
• EMILIN
• EMILIN-1
• gp115

Background

The EMILIN1 gene encodes an extracellular matrix glycoprotein that is characterized by an N-terminal microfibril interfacedomain, a coiled-coiled alpha-helical domain, a collagenous domain and a C-terminal globular C1q domain. The encodedprotein associates with

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for EMILIN1 Antibody (NBP1-84127)(6)

Publications using NBP1-84127

• Jacobson KR, Saleh AM, Lipp SN, Tian C et Al. Extracellular matrix protein composition dynamically changes during murine forelimb development iScience 2024-02-02 [PMID: 38303699]
• Favero G, Paini A, De Ciuceis C et al. Changes in extracellular matrix in subcutaneous small resistance arteries of patients with essential hypertension. Blood Press. 2018-03-09 [PMID: 29523048] (Human)
• Votteler M, Berrio DA, Horke A et al. Elastogenesis at the onset of human cardiac valve development. Development 2013-06-01 [PMID: 23637335]
• Edlund K, Lindskog C, Saito A et al. CD99 is a novel prognostic stromal marker in non-small cell lung cancer. Int J Cancer 2012-11-15 [PMID: 22392539]
• Jacobson K, Saleh A, Lipp S et al. Extracellular matrix protein composition dynamically changes during murine forelimb development bioRxiv 2020-06-19 (ICC/IF, Mouse)
• Lipp SN, Jacobson KR, Schwaderer AL et al. Foxd1 is Required for 3d Patterning of the Kidney Interstitial Matrix Developmental dynamics : an official publication of the American Association of Anatomists 2022-11-06 [PMID: 36335435] (IF/IHC, Mouse)

Reviews for EMILIN1 Antibody (NBP1-84127) (2)

Average Rating: 4

(Based on 2 reviews)

We have 2 reviews tested in 2 species: Human, Rat.

reviewed by: Catherine Heyward ICC Human 08/03/2021

Summary

• Application: Immunocytochemistry
• Sample Tested: Cell culture
• Species: Human
• Lot: A116271

Comments

• Comments: ***Bio-Techne Response: This review was submitted through the legacy Novus Innovators Program, reflecting a new species or application tested on a primary antibody.***

reviewed by: Catherine Heyward IHC-P Rat 08/03/2021

Summary

• Application: Immunohistochemistry-Paraffin
• Sample Tested: FFPE,IHC-P Sample Tested
• Species: Rat
• Lot: A116271

Comments

• Comments: Citrate buffer antigen retrieval 60C overnight. ***Bio-Techne Response: This review was submitted through the legacy Novus Innovators Program, reflecting a new species or application tested on a primary antibody.***

Bioinformatics

• Gene Symbol: EMILIN1