Home » EMILIN1 » EMILIN1 Antibodies » EMILIN1 Antibody

EMILIN1 Antibody

 (4 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: EMILIN1 Antibody [NBP1-84127] - Analysis in human cell line SH-SY5Y.
Western Blot: EMILIN1 Antibody [NBP1-84127] - Analysis in human cell line SH-SY5Y.
Immunohistochemistry-Paraffin: EMILIN1 Antibody [NBP1-84127] - Staining of human cerebral cortex shows no positivity in neurons as expected.
Immunohistochemistry-Paraffin: EMILIN1 Antibody [NBP1-84127] - Staining of human prostate shows strong membranous positivity in smooth muscle cells.
Immunohistochemistry-Paraffin: EMILIN1 Antibody [NBP1-84127] - Staining of human skin shows strong positivity in connective tissue.
Immunohistochemistry-Paraffin: EMILIN1 Antibody [NBP1-84127] - Staining of human testis shows moderate membranous positivity in peritubular myoid cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

EMILIN1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PQSIMYRRFLRPRYRVAYKTVTDMEWRCCQGYGGDDCAESPAPALGPASSTPRPLARPARPNLSGSSAGSPLSGLGGEGPGESEKVQQLEEQVQSLTKELQGLRGVLQGLSGRLAEDVQRAVETAFNGRQQPADAAARPGVHETLNE
Specificity
Specificity of human EMILIN1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EMILIN1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
EMILIN1 Recombinant Protein Antigen (NBP1-84127PEP)
Publications
Read Publications using
NBP1-84127 in the following applications:

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%). Reactivity reported in scientific literature (PMID: 23637335)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for EMILIN1 Antibody

  • DKFZp586M121
  • elastin microfibril interface-located protein 1
  • elastin microfibril interfacer 1
  • EMI
  • EMILIN
  • EMILIN-1
  • gp115

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Elastin Antibody
(BA-4)
NB100-2076
Western Blot: Elastin Antibody (BA-4) [NB100-2076] - Analysis of tropoelastin using the mAb BA-4 elastin antibody (NB100-2076). A: Western blot of tropoelastin purified from bovine ligamentum nuchae tissue minces. B: Autoradiogram of a gradient SDS-polyacrylamide gel showing [3H] leucine-labeled tropoelasti.
Immunohistochemistry-Paraffin: Elastin Antibody (BA-4) [NB100-2076] - Presence of ECM proteins collagen, elastin, fibronectin, vitronectin and GAGs following decellularization. Porcine vena cavas were decellularized and analyzed for ECM proteins. Cross-section of paraffin embedded samples were immunostained for collagen type I/III, elastin, fibronectin and vitronectin. Images were taken at identical microscopy settings. Scale bar is 100 um. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0220743), licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: Elastin Antibody (BA-4) [NB100-2076] - Elastin surrounding blood vessel in pig testis. Image from verified customer review.
(2 Reviews)
(5 Publications)
Species: Hu, Po, Ca, Fe, Gt, Gp, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
EMILIN2 Antibody
(828B3B3)
NBP2-36064
Western Blot: EMILIN2 Antibody (828B3B3) [NBP2-36064] - Recombinant protein obtained from supernatant of cells transduced with an Emilin-2 adenoviral construct.
Immunohistochemistry-Frozen: EMILIN2 Antibody (828B3B3) [NBP2-36064] - Staining of human Emilin-2 (green) in human colon-rectal tissue (frozen section). Nuclear staining with TO-PRO3 in blue. Scale bar: 37.00 um.
Species: Hu
Applications: WB, IHC, IHC-Fr
Fibronectin
Antibody
NBP1-91258
Western Blot: Fibronectin Antibody [NBP1-91258] - VSOP observed in perivascular-restricted spinal cord lesions with intact BBB. Immunostaining for laminin (brown) shows vascular endothelium and glia limitans of a perivascular lesion, along with infiltrating cells and VSOP (blue). Image collected and cropped by CiteAb from the following publication (http://asn.sagepub.com/lookup/doi/10.1042/AN20120081), licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: Fibronectin Antibody [NBP1-91258] - NIH-3T3 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton X-100. The cells were incubated with anti-Fibronectin at 2 ug/mL overnight at 4C and detected with an anti-rabbit DyLight 488 (Green) at 1:500. Alpha tubulin (DM1A) NB100-690 was used as a co-stain at 1:1000 and detected with an anti-mouse DyLight 550 (Red) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Frozen: Fibronectin Antibody [NBP1-91258] - Analysis in a 6 month old Alport mouse kidney. Image from a verified customer review.
(11 Reviews)
(32 Publications)
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
MMRN2 Antibody
H00079812-B01P
Western Blot: MMRN2 Antibody [H00079812-B01P] - Analysis of MMRN2 expression in transfected 293T cell line by MMRN2 polyclonal antibody. Lane 1: MMRN2 transfected lysate(104.39 KDa). Lane 2: Non-transfected lysate.
(2 Publications)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
CRAT Antibody
NBP1-86616
Immunohistochemistry-Paraffin: CRAT Antibody [NBP1-86616] - Analysis in human testis and lymph node tissues. Corresponding CRAT RNA-seq data are presented for the same tissues.
Western Blot: CRAT Antibody [NBP1-86616] - Analysis using Anti-CRAT antibody NBP1-86616 (A) shows similar pattern to independent antibody NBP1-86615 (B).
Western Blot: CRAT Antibody [NBP1-86616] - Analysis in human cell line TD47D.
Species: Hu
Applications: WB, IHC, IHC-P
Fucosyltransferase
2/FUT2 Antibody
NBP2-26116
Western Blot: Fucosyltransferase 2/FUT2 Antibody [NBP2-26116] - Staining of Human Liver lysate (35 ug protein in RIPA buffer). Primary incubation was 1 hour. Detected by chemiluminescence.
Immunohistochemistry-Paraffin: Fucosyltransferase 2/FUT2 Antibody [NBP2-26116] - Staining of Human Placenta. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
(1 Publication)
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
GM-CSF
[Unconjugated]
7954-GM/CF
GM-CSF [Unconjugated]
(1 Publication)
Species: Hu
Tenascin C
Antibody (4C8MS)
NB110-68136
Flow (Intracellular): Tenascin C Antibody (4C8MS) [NB110-68136] - Figure A: Intracellular stain performed on U87MG Cells with Tenascin C (4C8MS) antibody NB110-68136 (blue) and a matched isotype control NBP1-97005 (orange). Cells were fixed with 4% paraformaldehyde, following fixation, cells were permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by mouse F(ab)2 IgG (H+L) APC-conjugated secondary antibody [F0101B, R&D Systems].Figure B: U87MG Cells were either untreated (orange) or treated with 3uM Monensin (blue). An intracellular stain was performed with Tenascin C (4C8MS) antibody NB110-68136. Cells were fixed with 4% paraformaldehyde, following fixation, cells were permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by mouse F(ab)2 IgG (H+L) APC-conjugated secondary antibody [F0101B, R&D Systems].
Western Blot: Tenascin C Antibody (4C8MS) [NB110-68136] - Regulation of Tenascin C expression and its effect on fibrotic responses. Confluent foreskin fibroblasts were incubated with TGF-beta (10 ng ml-1 or indicated concentrations) or Tenascin C (TNC) for 24 or 72 h or indicated periods. Whole-cell lysates, culture media and RNA were examined by western analysis (upper panels) and qPCR (lower panel). Representative immunoblots or qPCR results (means+/-s.e.m. of triplicate determinations). S, secreted; L, lysates. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/doifinder/10.1038/ncomms11703), licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: Tenascin C Antibody (4C8MS) [NB110-68136] - SK-MEL-28 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.05% Triton-X100. The cells were incubated with anti-Tenascin C at 5 ug/ml overnight at 4C and detected with an anti-Mouse IgG Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
(2 Reviews)
(20 Publications)
Species: Hu, Mu, Rt, Fe
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
GLYAT Antibody
NBP2-58917
Western Blot: GLYAT Antibody [NBP2-58917] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma and human liver tissue.
Immunohistochemistry-Paraffin: GLYAT Antibody [NBP2-58917] - Staining of human skeletal muscle.
Immunohistochemistry-Paraffin: GLYAT Antibody [NBP2-58917] - Staining of human duodenum shows low expression as expected.
Species: Hu
Applications: WB, IHC, IHC-P
Catalase Antibody
NBP2-24916
Western Blot: Catalase Antibody [NBP2-24916] - Analysis in liver lysate of 1) human 2) mouse and 3) rat at 0.1 ug/ml.
Immunohistochemistry-Paraffin: Catalase Antibody [NBP2-24916] - Staining of human liver tissue using an isotype control (top) and this antibody (bottom) at 5 ug/ml.
(1 Review)
(7 Publications)
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
LAMC2 Antibody
(CL2980)
NBP2-42388
Immunohistochemistry-Paraffin: LAMC2 Antibody (CL2980) [NBP2-42388] - Staining in human fallopian tube and liver tissues. Corresponding LAMC2 RNA-seq data are presented for the same tissues.
Western Blot: LAMC2 Antibody (CL2980) [NBP2-42388] - Analysis in A-431 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-LAMC2 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Immunocytochemistry/Immunofluorescence: LAMC2 Antibody (CL2980) [NBP2-42388] - Staining of A-431 cells using the Anti-LAMC2 monoclonal antibody, showing specific staining in the cytosol in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available).
(2 Publications)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
SQLE Antibody
NBP2-32005
Western Blot: SQLE Antibody [NBP2-32005] - Analysis in human cell line MCF-7 and human cell line U-251 MG.
Immunohistochemistry-Paraffin: SQLE Antibody [NBP2-32005] - Staining in human testis and skeletal muscle tissues using NBP2-32005 antibody. Corresponding SQLE RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: SQLE Antibody [NBP2-32005] - Staining of human colon shows moderate cytoplasmic positivity in glandular cells.
Species: Hu
Applications: WB, IHC, IHC-P
CD45 Antibody
(30-F11)
NB100-77417
Flow Cytometry: CD45 Antibody (30-F11) [NB100-77417] - Analysis of CD45 (30F11) in freshly isolated mouse (Balb C) splenocytes (1x10^6) were stained with [NB100-77417] at 1:1000 dilution and detected with FITC conjugated donkey anti-rat IgG secondary (orange). Shown with rat IgG isotype control (blue).
Immunohistochemistry-Paraffin: CD45 Antibody (30-F11) [NB100-77417] - Analysis of FFPE section of mouse spleen using rat monoclonal CD45 antibody (30-F11) [NB100-77417] at 1:50 dilution. The antibody generated an expected membrane staining in the red and white pulp spleenocytes of the tested spleen section.
Immunohistochemistry-Paraffin: CD45 Antibody (30-F11) [NB100-77417] - Staining of a FFPE mouse liver tissue section using 1:100 dilution of CD45 antibody (30-F11) [NB100-77417]. Signal was detected using AF488 conjugated donkey anti-rat secondary antibody at 1:500 dilution. Image submitted via verified customer review.
(4 Reviews)
(26 Publications)
Species: Hu, Mu, Rt
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, In vivo, CyTOF-ready
Fibrillin 1
Antibody (11C1.3)
NB110-8146
Immunocytochemistry/Immunofluorescence: Fibrillin 1 Antibody (11C1.3) [NB110-8146] - Analysis of Fibrillin-1 (green) showing staining in the cytoplasm of SH-SY5Y cells (right) compared to a negative control without primary antibody (left).
Immunohistochemistry-Frozen: Fibrillin 1 Antibody (11C1.3) [NB110-8146] - Adult eye (blue) and muscle (red) tissue. An image was captured using epifluorescent microscope detecting signals from Alexa fluor 568 conjugated secondary antibody. Used at 1:100 dilution. Image from verified customer review.
Immunocytochemistry/Immunofluorescence: Fibrillin 1 Antibody (11C1.3) [NB110-8146] - Analysis of Fibrillin-1 (green) showing staining in the cytoplasm of A431 cells (right) compared to a negative control without primary antibody (left).
(1 Review)
(3 Publications)
Species: Hu, Po, Bv, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IM
PRB1
Overexpression Lysate
NBP2-04611
Western Blot: PRB1 Overexpression Lysate (Adult Normal) [NBP2-04611] Left-Empty vector transfected control cell lysate (HEK293 cell lysate); Right -Over-expression Lysate for PRB1.
Species: Hu
Ketohexokinase
Antibody
NBP1-85790
Western Blot: Ketohexokinase Antibody [NBP1-85790] - Western blot analysis in mouse liver tissue and rat liver tissue.
Immunohistochemistry-Paraffin: Ketohexokinase Antibody [NBP1-85790] - Staining in human small intestine and skeletal muscle tissues. Corresponding KHK RNA-seq data are presented for the same tissues.
Western Blot: Ketohexokinase Antibody [NBP1-85790] - Analysis in human cell line HepG2.
(3 Publications)
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
LOX Antibody
NB100-2527
Western Blot: LOX Antibody [NB100-2527] - LOX secretion and activity in response to tumor cell irradiation. Western blot of LOX zymogen (50 kDa) and active form (32 kDa) in conditioned media derived from irradiated A549 lung carcinoma cells 16-20 h after irradiation and quantification of band intensities from 3 independent experiments. Image collected and cropped by CiteAb from the following publication (http://bmccancer.biomedcentral.com/articles/10.1186/1471-2407-14-532) licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: LOX Antibody [NB100-2527] - Expression of Lox and Loxl1-Loxl4 mRNAs in orthotopic rat prostate tumours and in the surrounding normal rat prostate tissue. Representative sections from a 10-day orthotopic AT-1 rat prostate tumour (T), tumour-adjacent normal rat prostate tissue (N), and tumour-free control rat prostate tissue stained for LOX (inserts show LOX staining in higher magnifications). Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/srep19608), licensed under a CC-BY licence.
Simple Western: LOX Antibody [NB100-2527] - Simple Western shows a specific band for LOX in 1.0 mg/ml of HeLa cell lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
(5 Reviews)
(27 Publications)
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KD
CD43/Sialophorin
Antibody (W3/13)
NB100-64992
Western Blot: CD43/Sialophorin Antibody (W3/13) [NB100-64992] - Western blot shows lysates of rat lymph node, rat spleen tissue, and rat thymus tissue. PVDF membrane was probed with 0.5 ug/mL of Mouse Anti-Rat CD43 Monoclonal Antibody (Catalog # NB100-64992) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). A specific band was detected for CD43 at approximately 90 kDa (as indicated). This experiment was conducted under reducing conditions.
Immunohistochemistry-Paraffin: CD43/Sialophorin Antibody (W3/13) [NB100-64992] - CD43 was detected in immersion fixed paraffin-embedded sections of rat thymus using Mouse Anti-Rat CD43 Monoclonal Antibody (Catalog # NB100-64992) at 5 ug/mL for 1 hour at room temperature followed by incubation with the Anti-Mouse IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC001). Before incubation with the primary antibody, tissue was incubated with VisUBlock™ Mouse on Mouse Blocking Reagent (Catalog # VB001) and then subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to lymphocytes.
Flow Cytometry: CD43/Sialophorin Antibody (W3/13) [NB100-64992] - Staining of rat splenocytes using CD43 FITC.
(3 Publications)
Species: Rt
Applications: WB, Flow, IHC, IHC-Fr, IHC-P
CDP/CUTL1 Antibody
NBP2-13883
Western Blot: CDP/CUTL1 Antibody [NBP2-13883] - Analysis in human thyroid gland tissue.
Immunocytochemistry/Immunofluorescence: CDP/CUTL1 Antibody [NBP2-13883] - Staining of human cell line MCF7 shows localization to nucleoplasm and the Golgi apparatus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: CDP/CUTL1 Antibody [NBP2-13883] - Staining of human liver shows no positivity in hepatocytes as expected.
(2 Reviews)
(2 Publications)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, MiAr
EMILIN1 Antibody
NBP1-84127
EMILIN1 Antibody
Species: Hu
Applications: WB, IHC, IHC-P

Publications for EMILIN1 Antibody (NBP1-84127)(4)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 1 application: ICC/IF.


Filter By Application
ICC/IF
(1)
All Applications
Filter By Species
Human
(1)
Mouse
(1)
All Species

Reviews for EMILIN1 Antibody (NBP1-84127) (0)

There are no reviews for EMILIN1 Antibody (NBP1-84127). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EMILIN1 Antibody (NBP1-84127) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional EMILIN1 Products

Bioinformatics Tool for EMILIN1 Antibody (NBP1-84127)

Discover related pathways, diseases and genes to EMILIN1 Antibody (NBP1-84127). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EMILIN1 Antibody (NBP1-84127)

Discover more about diseases related to EMILIN1 Antibody (NBP1-84127).
 

Pathways for EMILIN1 Antibody (NBP1-84127)

View related products by pathway.

PTMs for EMILIN1 Antibody (NBP1-84127)

Learn more about PTMs related to EMILIN1 Antibody (NBP1-84127).

Blogs on EMILIN1

There are no specific blogs for EMILIN1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EMILIN1 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol EMILIN1