EMILIN1 Antibody

Images

 
Western Blot: EMILIN1 Antibody [NBP1-84127] - Analysis in human cell line SH-SY5Y.
Immunohistochemistry-Paraffin: EMILIN1 Antibody [NBP1-84127] - Staining of human cerebral cortex shows no positivity in neurons as expected.
Immunohistochemistry-Paraffin: EMILIN1 Antibody [NBP1-84127] - Staining of human prostate shows strong membranous positivity in smooth muscle cells.
Immunohistochemistry-Paraffin: EMILIN1 Antibody [NBP1-84127] - Staining of human skin shows strong positivity in connective tissue.
Immunohistochemistry-Paraffin: EMILIN1 Antibody [NBP1-84127] - Staining of human testis shows moderate membranous positivity in peritubular myoid cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

EMILIN1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PQSIMYRRFLRPRYRVAYKTVTDMEWRCCQGYGGDDCAESPAPALGPASSTPRPLARPARPNLSGSSAGSPLSGLGGEGPGESEKVQQLEEQVQSLTKELQGLRGVLQGLSGRLAEDVQRAVETAFNGRQQPADAAARPGVHETLNE
Specificity
Specificity of human EMILIN1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EMILIN1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
EMILIN1 Recombinant Protein Antigen (NBP1-84127PEP)
Publications
Read Publications using
NBP1-84127 in the following applications:

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%). Reactivity reported in scientific literature (PMID: 23637335)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for EMILIN1 Antibody

  • DKFZp586M121
  • elastin microfibril interface-located protein 1
  • elastin microfibril interfacer 1
  • EMI
  • EMILIN
  • EMILIN-1
  • gp115

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2076
Species: Hu, Po, Ca, Fe, Gt, Gp, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-36064
Species: Hu
Applications: WB, IHC, IHC-Fr
NBP1-91258
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
H00079812-B01P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-86616
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-26116
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
7954-GM/CF
Species: Hu
NB110-68136
Species: Hu, Mu, Rt, Fe
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NBP2-58917
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-42388
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-32005
Species: Hu
Applications: WB, IHC, IHC-P
NB100-77417
Species: Hu, Mu, Rt
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, In vivo, CyTOF-ready
NB110-8146
Species: Hu, Po, Bv, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IM
NBP2-04611
Species: Hu
NBP1-85790
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-2527
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KD
NB100-64992
Species: Rt
Applications: WB, Flow, IHC, IHC-Fr, IHC-P
NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, MiAr
NBP1-84127
Species: Hu
Applications: WB, IHC, IHC-P

Publications for EMILIN1 Antibody (NBP1-84127)(4)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 1 application: ICC/IF.


Filter By Application
ICC/IF
(1)
All Applications
Filter By Species
Human
(1)
Mouse
(1)
All Species

Reviews for EMILIN1 Antibody (NBP1-84127) (0)

There are no reviews for EMILIN1 Antibody (NBP1-84127). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EMILIN1 Antibody (NBP1-84127) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional EMILIN1 Products

Bioinformatics Tool for EMILIN1 Antibody (NBP1-84127)

Discover related pathways, diseases and genes to EMILIN1 Antibody (NBP1-84127). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EMILIN1 Antibody (NBP1-84127)

Discover more about diseases related to EMILIN1 Antibody (NBP1-84127).
 

Pathways for EMILIN1 Antibody (NBP1-84127)

View related products by pathway.

PTMs for EMILIN1 Antibody (NBP1-84127)

Learn more about PTMs related to EMILIN1 Antibody (NBP1-84127).

Blogs on EMILIN1

There are no specific blogs for EMILIN1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EMILIN1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EMILIN1