GAK Antibody (4C10)

Images

 
Western Blot: GAK Antibody (4C10) [H00002580-M01] - GAK monoclonal antibody (M01), clone 4C10 Analysis of GAK expression in Hela S3 NE.
Western Blot: GAK Antibody (4C10) [H00002580-M01] - Analysis of GAK expression in transfected 293T cell line by GAK monoclonal antibody (M01), clone 4C10.Lane 1: GAK transfected lysate (Predicted MW: 44 KDa).Lane 2: ...read more
Immunoprecipitation: GAK Antibody (4C10) [H00002580-M01] - Analysis of GAK transfected lysate using anti-GAK monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with GAK monoclonal antibody.
Sandwich ELISA: GAK Antibody (4C10) [H00002580-M01] - Detection limit for recombinant GST tagged GAK is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IP
Clone
4C10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

GAK Antibody (4C10) Summary

Immunogen
GAK (AAH08668, 151 a.a. - 250 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SAVAPTPATEGPLFSPGGQPAPCGSQASWTKSQNPDPFADLGDLSSGLQGSPAGFPPGGFIPKTATTPKGSSSWQTSRPPAQGASWPPQAKPPPKACTQP
Localization
Cytoplasm, perinuclear region. Golgi apparatus, trans Golgi network. Cell junction, focal adhesion. Localizes to the perinuclear area and to the trans Golgi network. Also seen on the plasma membrane, probably at focal adhesions.
Specificity
GAK - cyclin G associated kinase
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
GAK
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunoprecipitation
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GAK Antibody (4C10)

  • Auxillin 2
  • cyclin G associated kinase
  • cyclin-G-associated kinase
  • EC 2.7.11.1
  • FLJ16629
  • FLJ40395
  • GAK
  • MGC99654

Background

In all eukaryotes, the cell cycle is governed by cyclin-dependent protein kinases (CDKs), whose activities are regulated by cyclins and CDK inhibitors in a diverse array of mechanisms that involve the control of phosphorylation and dephosphorylation of Ser, Thr or Tyr residues. Cyclins are molecules that possess a consensus domain called the 'cyclin box.' In mammalian cells, 9 cyclin species have been identified, and they are referred to as cyclins A through I. Cyclin G is a direct transcriptional target of the p53 tumor suppressor gene product and thus functions downstream of p53. GAK is an association partner of cyclin G and CDK5.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00000900-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-26380
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-81507
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-97868
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, GP, Ha, Mk, Rb, Sh
Applications: WB, EM, EIA, Flow, ICC/IF, IHC, IHC-P, IP
AF4736
Species: Hu
Applications: WB
NB300-268
Species: Hu, Mu, Bv, Ce
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
MAB6886
Species: Hu
Applications: WB
NBP2-38121
Species: Hu
Applications: IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
AF1029
Species: Mu
Applications: WB, IHC, IP
NB100-74359
Species: Hu, Mu, Ch
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
MAB6598
Species: Hu, Mu, Rt
Applications: WB
NB300-206
Species: Hu, Mu, Rt, Ba
Applications: WB, IHC, IP
NBP2-55775
Species: Hu
Applications: WB, ICC/IF
H00008767-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP1-87001
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-48021
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF1443
Species: Mu, Rt
Applications: WB, Simple Western, IHC, ICC
H00002580-M01
Species: Hu
Applications: WB, ELISA, IP

Publications for GAK Antibody (H00002580-M01) (0)

There are no publications for GAK Antibody (H00002580-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GAK Antibody (H00002580-M01) (0)

There are no reviews for GAK Antibody (H00002580-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GAK Antibody (H00002580-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GAK Products

Bioinformatics Tool for GAK Antibody (H00002580-M01)

Discover related pathways, diseases and genes to GAK Antibody (H00002580-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GAK Antibody (H00002580-M01)

Discover more about diseases related to GAK Antibody (H00002580-M01).
 

Pathways for GAK Antibody (H00002580-M01)

View related products by pathway.

PTMs for GAK Antibody (H00002580-M01)

Learn more about PTMs related to GAK Antibody (H00002580-M01).
 

Research Areas for GAK Antibody (H00002580-M01)

Find related products by research area.

Blogs on GAK

There are no specific blogs for GAK, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GAK Antibody (4C10) and receive a gift card or discount.

Bioinformatics

Gene Symbol GAK
Entrez
OMIM
Uniprot