MMR/CD206/Mannose Receptor Recombinant Protein Antigen

Images

 
There are currently no images for MMR/CD206/Mannose Receptor Protein (NBP1-90020PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

MMR/CD206/Mannose Receptor Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MRC1.

Source: E.coli

Amino Acid Sequence: NEDHKRCVDAVSPSAVQTAACNQDAESQKFRWVSESQIMSVAFKLCLGVPSKTDWVAITLYACDSKSEFQKWECKNDTLLGIKGEDLFFNYGNRQEKNIMLYKGSGLWSRWKIYG

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MRC1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-90020.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using NBP1-90020PEP.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for MMR/CD206/Mannose Receptor Recombinant Protein Antigen

  • CD206
  • CLEC13D
  • CLEC13Dmacrophage mannose receptor 1
  • C-type lectin domain family 13 member D
  • mannose receptor, C type 1
  • MMR
  • MMRCD206 antigen
  • MRC1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67381
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-621
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-37537
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-46459
Species: Hu
Applications: WB, IHC, IHC-P, IF
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-19417
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-09011
Species: Hu
NB100-56546
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-66987
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP2-45041
Species: Hu, Po
Applications: Flow, ICC/IF, IF
NB100-168
Species: Hu, Mu(-)
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, Flow-IC
NBP2-93743
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90020PEP
Species: Hu
Applications: AC

Publications for MMR/CD206/Mannose Receptor Protein (NBP1-90020PEP)(1)

Reviews for MMR/CD206/Mannose Receptor Protein (NBP1-90020PEP) (0)

There are no reviews for MMR/CD206/Mannose Receptor Protein (NBP1-90020PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MMR/CD206/Mannose Receptor Protein (NBP1-90020PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional MMR/CD206/Mannose Receptor Products

Bioinformatics Tool for MMR/CD206/Mannose Receptor Protein (NBP1-90020PEP)

Discover related pathways, diseases and genes to MMR/CD206/Mannose Receptor Protein (NBP1-90020PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MMR/CD206/Mannose Receptor Protein (NBP1-90020PEP)

Discover more about diseases related to MMR/CD206/Mannose Receptor Protein (NBP1-90020PEP).
 

Pathways for MMR/CD206/Mannose Receptor Protein (NBP1-90020PEP)

View related products by pathway.

PTMs for MMR/CD206/Mannose Receptor Protein (NBP1-90020PEP)

Learn more about PTMs related to MMR/CD206/Mannose Receptor Protein (NBP1-90020PEP).
 

Research Areas for MMR/CD206/Mannose Receptor Protein (NBP1-90020PEP)

Find related products by research area.

Blogs on MMR/CD206/Mannose Receptor.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MMR/CD206/Mannose Receptor Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MRC1