Home » MMR/CD206/Mannose Receptor » MMR/CD206/Mannose Receptor Proteins » MMR/CD206/Mannose Receptor Recombinant Protein Antigen

MMR/CD206/Mannose Receptor Recombinant Protein Antigen

 (1 Publication)
 See All Related
Submit a Review

Images

 
There are currently no images for MMR/CD206/Mannose Receptor Protein (NBP1-90020PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

MMR/CD206/Mannose Receptor Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MRC1.

Source: E.coli

Amino Acid Sequence: NEDHKRCVDAVSPSAVQTAACNQDAESQKFRWVSESQIMSVAFKLCLGVPSKTDWVAITLYACDSKSEFQKWECKNDTLLGIKGEDLFFNYGNRQEKNIMLYKGSGLWSRWKIYG
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MRC1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-90020.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using NBP1-90020PEP.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for MMR/CD206/Mannose Receptor Recombinant Protein Antigen

  • CD206
  • CLEC13D
  • CLEC13Dmacrophage mannose receptor 1
  • C-type lectin domain family 13 member D
  • mannose receptor, C type 1
  • MMR
  • MMRCD206 antigen
  • MRC1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MLH1 Antibody
(SP08-04)
NBP2-67381
Western Blot: MLH1 Antibody (SP08-04) [NBP2-67381] - Western blot analysis of MLH1 on different lysates. Proteins were transferred to a PVDF membrane and blocked with 5% BSA in PBS for 1 hour at room temperature. The primary antibody (1/500) was used in 5% BSA at room temperature for 2 hours. Goat Anti-Rabb
Immunocytochemistry/Immunofluorescence: MLH1 Antibody (SP08-04) [NBP2-67381] - Staining MLH1 in HepG2 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: MLH1 Antibody (SP08-04) [NBP2-67381] - Immunohistochemical analysis of paraffin-embedded rat large intestine tissue using anti-MLH1 antibody. The section was pre-treated using heat mediated antigen retrieval with Tris-EDTA buffer (pH 8.0-8.4) for 20 minutes. The tissues were blocked in 5% BSA for 30 minutes at room temperature, washed with ddH2O and PBS, and then probed with the primary antibody (ET1604-41, 1/200) for 30 minutes at room temperature. The detection was performed using an HRP conjugated compact polymer system. DAB was used as the chromogen. Tissues were counterstained with hematoxylin and mounted with DPX.
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
MSH2 Antibody
NB100-621
Western Blot: MSH2 Antibody [NB100-621] - Detection of Human and Mouse MSH2 by Western Blot. Samples: Whole cell lysate (50 ug) from HeLa, 293T, and mouse NIH3T3 cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-MSH2 antibody NB100-621 used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
Immunohistochemistry-Paraffin: MSH2 Antibody [NB100-621] - Sample: FFPE section of human ovarian carcinoma. Antibody: Affinity purified rabbit anti-MSH2 used at a dilution of 1:1,000 (1ug/ml). Detection: DAB
Western Blot: MSH2 Antibody [NB100-621] - Detection of human and mouse MSH2 by Western blot and immunoprecipitation using NB100-621. Detection: ECL with a 3 minute exposure.
(1 Publication)
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
MSH6 Antibody (3E1)
NBP2-37537
Western Blot: MSH6 Antibody (3E1) [NBP2-37537] - Western blot analysis using MSH6 mouse mAb against HEK293 (1), HCT116 (2), A549 (3), A431 (4), MCF-7 (5) and HepG2 (6) cell lysate.
Immunocytochemistry/Immunofluorescence: MSH6 Antibody (3E1) [NBP2-37537] - Immunofluorescence analysis of Hela cells using MSH6 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: MSH6 Antibody (3E1) [NBP2-37537] - Analysis of colon cancer tissues using MSH6 mouse mAb with DAB staining.
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
PMS2 Antibody
(OTI2G5)
NBP2-46459
Western Blot: PMS2 Antibody (OTI2G5) [NBP2-46459] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY PMS2.
Immunohistochemistry: PMS2 Antibody (OTI2G5) [NBP2-46459] - Analysis of Carcinoma of Human pancreas tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Immunohistochemistry: PMS2 Antibody (OTI2G5) [NBP2-46459] - Analysis of Adenocarcinoma of Human breast tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
(1 Publication)
Species: Hu
Applications: WB, IHC, IHC-P, IF
p53 Antibody (PAb
240)
NB200-103
Western Blot: p53 Antibody (PAb 240) [NB200-103] - Analysis of p53 in MCF7 and HeLa lystates. Image courtesy of anonymous customer product review.
Immunocytochemistry/Immunofluorescence: p53 Antibody (PAb 240) [NB200-103] - PC12 cells were fixed in 4% paraformaldehyde for 10 minutes and permeabilized in 0.5% Triton X-100 in PBS for 5 minutes. The cells were incubated with anti-p53 Antibody (PAb 240) NB200-103 at 2 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:1000 dilution for 60 minutes. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: p53 Antibody (PAb 240) [NB200-103] - p53 was detected in immersion fixed paraffin-embedded sections of human prostate cancer using anti-human mouse monoclonal antibody (Catalog # NB200-103) at 1:200 dilution overnight at 4C. Tissue was stained using the VisuCyte anti-mouse HRP polymer detection reagent (Catalog # VC001) with DAB chromogen (brown) and counterstained with hematoxylin (blue). Images may not be copied, printed or otherwise disseminated without express written permission of Novus Biologicals a bio-techne brand.
(3 Reviews)
(30 Publications)
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
MSH3 Antibody
NBP2-19417
Western Blot: MSH3 Antibody [NBP2-19417] - H1299 whole cell and nuclear extracts (30 ug) were separated by 5% SDS-PAGE, and the membrane was blotted with MSH3 antibody [C2C3], C-term diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: MSH3 Antibody [NBP2-19417] - MSH3 antibody [C2C3], C-term detects MSH3 protein at nucleus by immunofluorescent analysis.Sample: HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min.Green: MSH3 stained by MSH3 antibody [C2C3], C-term diluted at 1:500.Blue: Fluoroshield with DAPI.Scale bar= 10 um.
Immunohistochemistry-Paraffin: MSH3 Antibody [NBP2-19417] - MSH3 antibody [C2C3], C-term detects MSH3 protein at nucleus by immunohistochemical analysis.Sample: Paraffin-embedded human lung cancer.MSH3 stained by MSH3 antibody [C2C3], C-term diluted at 1:600.Antigen Retrieval: Citrate buffer, pH 6.0, 15 min
(2 Publications)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
PMS1
Overexpression Lysate
NBP2-09011
Western Blot: PMS1 Overexpression Lysate (Adult Normal) [NBP2-09011] Left-Empty vector transfected control cell lysate (HEK293 cell lysate); Right -Over-expression Lysate for PMS1.
Species: Hu
Chk2 Antibody
(73C175.1.1)
NB100-56546
Western Blot: Chk2 Antibody (73C175.1.1) [NB100-56546] - Western Blot: Chk2 Antibody (73C175.1.1) - Azide Free [NBP2-27403] - analysis of Chk2 in 293 cell lysate. A protein band of approximate molecular weight of 60-62 kDa is detected with Chk2 antibody at 2 ug/ml. Image using the Azide Free form of this antibody.
Immunocytochemistry/Immunofluorescence: Chk2 Antibody (73C175.1.1) [NB100-56546] - Hek293 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.5% Triton-X100. The cells were incubated with anti-Chk2 (73C175.1.1) at 5 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: Chk2 Antibody (73C175.1.1) [NB100-56546] - Staining of human spleen. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 10 ug/ml.
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
IL-10 [Biotin]
DY417
(7 Reviews)
(195 Publications)
Species: Mu
APC Antibody
NB100-91662
Western Blot: APC Antibody [NB100-91662] - Lane1:Hela cell lysate. Lane2:HEK293T cell lysate. Lane3:Rat testis tissue lysate.
Immunocytochemistry/Immunofluorescence: APC Antibody [NB100-91662] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.05% Triton-X100. The cells were incubated with anti-APC Antibody at 2 ug/ml overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: APC Antibody [NB100-91662] - IHC-P analysis of a formalin fixed paraffin embedded tissue section of human colon cancer xenograft using 1: 50 dilution of APC antibody.
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(35 Reviews)
(651 Publications)
Species: Hu
IL-4 [Unconjugated]
6507-IL/CF
IL-4 [Unconjugated]
(3 Publications)
Species: Hu
NOD2 Antibody (2D9)
NB100-524
Western Blot: NOD2 Antibody (2D9) [NB100-524] - HCMV infection induces NOD2 mRNA and protein in HFFs and U373 cells. E. U373 glioma cells were infected with HCMV Towne strain and levels of NOD1, NOD2 and GAPDH mRNAs were measured by qRT-PCR at indicated time points. F. HFFs were infected with HCMV (Towne) at MOI of 1 PFU/cell and levels of NOD2 protein and B-actin were determined 48 and 72 hpi. G. HFFs were infected with HCMV (Towne) strain at MOI of 0.03 or 3 PFU/cell and levels of NOD2 protein and B-actin were determined at 48 hpi. Quantitative data represent mean values (+/-SD) of triplicate determinations from three independent experiments (*p<0.05, **p<0.01, ***p<0.001, one-way ANOVA test). Image collected and cropped by CiteAb from the following publication (//doi.org/10.1371/journal.pone.0092704.g001) licensed under a CC-BY licence.
Western Blot: NOD2 Antibody (2D9) [NB100-524] - Total protein from human THP1 and US-OS cells and mouse Raw264.7 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-NOD2 in 1% non-fat milk in TBST and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Immunohistochemistry-Frozen: NOD2 Antibody (2D9) [NB100-524] - Overlay of NOD2-DyLight 488 (green) with phase contrast of murine colon. Image from verified customer review.
(1 Review)
(23 Publications)
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
Coagulation Factor
XIV/Protein C Antibod ...
NBP2-66987
Immunocytochemistry/Immunofluorescence: Coagulation Factor XIV/Protein C Antibody (JM93-61) [NBP2-66987] - Staining Protein C in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: Coagulation Factor XIV/Protein C Antibody (JM93-61) [NBP2-66987] - Analysis of paraffin-embedded human stomach cancer tissue using anti-Protein C antibody. Counter stained with hematoxylin.
Immunocytochemistry/Immunofluorescence: Coagulation Factor XIV/Protein C Antibody (JM93-61) [NBP2-66987] - Staining Protein C in 293T cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
PCNA Antibody
(PC10)
NB500-106
Simple Western: PCNA Antibody (PC10) [NB500-106] - Image shows a specific band for PCNA in 0.5 mg/mL of HeLa lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
Immunohistochemistry: PCNA Antibody (PC10) [NB500-106] - Development of the germinal zones in the tree shrew neocortex. Immunofluorescence for PCNA (yellow) and DAPI staining (blue) on 30 um-cryosections of E32-P1 tree shrew neocortex. The top margin of the image corresponds to the transition zone SVZ/intermediate zone. Scale bars, 50 um. VZ, ventricular zone; SVZ, subventricular zone; iSVZ, inner SVZ; oSVZ, outer SVZ. Image collected and cropped by CiteAb from the following publication (http://journal.frontiersin.org/article/10.3389/fnana.2018.00029/full), licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: PCNA Antibody (PC10) [NB500-106] - Analysis of paraffin-embedded human colon carcinoma, showing nuclear localization.
(5 Reviews)
(33 Publications)
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
HLA DQ Antibody
(SPV-L3)
NBP2-45041
Flow Cytometry: HLA DQ Antibody (SPV-L3) [NBP2-45041] - Flow Cytometric Analysis of Raji cells. HLA DQ Antibody (SPV-L3) followed by goat anti-Mouse IgG-CF488 (Blue); Isotype Control (Red).
(1 Publication)
Species: Hu, Po
Applications: Flow, ICC/IF, IF
CTLA-4
[Unconjugated]
7268-CT
Recombinant Human CTLA-4 Fc Chimera (Catalog # 7268-CT) inhibits IL-2 secretion by stimulated Jurkat human acute Tcell leukemia cells. The ED50 for this effect is 0.03-0.15 μg/mL whenstimulated with 1 μg/mL Recombinant Human B7‑1/CD80 Fc Chimera (Catalog # 140-B1).
(3 Reviews)
(1 Publication)
Species: Hu
MGMT Antibody (MT
23.2)
NB100-168
Western Blot: MGMT Antibody (MT 23.2) [NB100-168] - Detection of MGMT in MCF7 lysate using NB100-168 at 1:1000 dilution.
Immunocytochemistry/Immunofluorescence: MGMT Antibody (MT 23.2) [NB100-168] - Detection of MGMT (Green) in Hela cells using NB100-168 at a 1:50 dilution. Nuclei (Blue) are counterstained using Hoechst 33258.
Immunohistochemistry-Paraffin: MGMT Antibody (MT 23.2) [NB100-168] - IHC analysis of a formalin fixed paraffin-embedded (FFPE) human kidney using 1:2000 conc. of MGMT antibody (clone MT 23.2) on a Bond Rx autostainer (Leica Biosystems). The assay involved 20 minutes of heat induced antigen retrieval (HIER) using 10mM sodium citrate buffer (pH 6.0) and endogenous peroxidase quenching with peroxide block. The sections were incubated with primary antibody for 30 minutes and Bond Polymer Refine Detection (Leica Biosystems) with DAB was used for signal development followed by counterstaining with hematoxylin. Whole slide scanning and capturing of representative images was performed using Aperio AT2 (Leica Biosystems). Nuclear staining of MGMT was observed. Staining was performed by Histowiz.
(19 Publications)
Species: Hu, Mu(-)
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, Flow-IC
NDUFA2 Antibody
NBP2-93743
Western Blot: NDUFA2 Antibody [NBP2-93743] - Analysis of extracts of various cell lines, using NDUFA2 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.
Immunocytochemistry/Immunofluorescence: NDUFA2 Antibody [NBP2-93743] - Analysis of NIH/3T3 cells using NDUFA2 at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: NDUFA2 Antibody [NBP2-93743] - Paraffin-embedded human liver cancer using NDUFA2.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MMR/CD206/Mannose
Receptor Recombinant ...
NBP1-90020PEP
MMR/CD206/Mannose Receptor Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for MMR/CD206/Mannose Receptor Protein (NBP1-90020PEP)(1)


Reviews for MMR/CD206/Mannose Receptor Protein (NBP1-90020PEP) (0)

There are no reviews for MMR/CD206/Mannose Receptor Protein (NBP1-90020PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MMR/CD206/Mannose Receptor Protein (NBP1-90020PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Learn about Custom Antibody Labeling

Additional MMR/CD206/Mannose Receptor Products

Bioinformatics Tool for MMR/CD206/Mannose Receptor Protein (NBP1-90020PEP)

Discover related pathways, diseases and genes to MMR/CD206/Mannose Receptor Protein (NBP1-90020PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MMR/CD206/Mannose Receptor Protein (NBP1-90020PEP)

Discover more about diseases related to MMR/CD206/Mannose Receptor Protein (NBP1-90020PEP).
 

Pathways for MMR/CD206/Mannose Receptor Protein (NBP1-90020PEP)

View related products by pathway.

PTMs for MMR/CD206/Mannose Receptor Protein (NBP1-90020PEP)

Learn more about PTMs related to MMR/CD206/Mannose Receptor Protein (NBP1-90020PEP).
 

Research Areas for MMR/CD206/Mannose Receptor Protein (NBP1-90020PEP)

Find related products by research area.

Blogs on MMR/CD206/Mannose Receptor.

Check out the latest blog posts on MMR/CD206/Mannose Receptor.

  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MMR/CD206/Mannose Receptor Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol MRC1