MMR/CD206/Mannose Receptor Antibody - BSA Free

Immunohistochemistry-Paraffin: MMR/CD206/Mannose Receptor Antibody [NBP1-90020] - Staining of human cerebral cortex, liver, lung and placenta using Anti-MMR/CD206/Mannose Receptor antibody NBP1-90020 (A) shows similar protein distribution across tissues to independent antibody NBP2-33439 (B).

Analysis in human lung and cerebral cortex tissues using NBP1-90020 antibody. Corresponding MRC1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: MMR/CD206/Mannose Receptor Antibody [NBP1-90020] - Staining of human lung shows moderate to strong cytoplasmic positivity in macrophages.

Immunohistochemistry-Paraffin: MMR/CD206/Mannose Receptor Antibody [NBP1-90020] - Staining of human cerebral cortex shows no cytoplasmic positivity in neuronal cells.

Immunohistochemistry-Paraffin: MMR/CD206/Mannose Receptor Antibody [NBP1-90020] - Staining of human liver shows moderate cytoplasmic positivity in Kupffer cells.

Immunohistochemistry-Paraffin: MMR/CD206/Mannose Receptor Antibody [NBP1-90020] - Staining of human placenta shows moderate to strong cytoplasmic positivity in Hofbauer cells.

Analysis in human liver tissue.

nbp1-90020_rabbit-polyclonal-mmr-cd206-mannose-receptor-antibody-25520231539517.jpg

• Reactivity: Hu, Mu, Po, Pm
• Applications: WB, Flow, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MMR/CD206/Mannose Receptor Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: NEDHKRCVDAVSPSAVQTAACNQDAESQKFRWVSESQIMSVAFKLCLGVPSKTDWVAITLYACDSKSEFQKWECKNDTLLGIKGEDLFFNYGNRQEKNIMLYKGSGLWSRWKIYG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MRC1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Flow Cytometry Validated from a verified customer review
  • Immunocytochemistry/ Immunofluorescence Reported in scientific literature (PMID 28620274).
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  MMR/CD206/Mannose Receptor Protein (NBP1-90020PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (86%). Porcine reactivity reported in scientific literature (PMID: 24048008). Mouse reactivity reported in scientific literature (PMID: 28620274). Primate reactivity reported in scientific literature (PMID: 26067369).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for MMR/CD206/Mannose Receptor Antibody - BSA Free

• CD206
• CLEC13D
• CLEC13Dmacrophage mannose receptor 1
• C-type lectin domain family 13 member D
• mannose receptor, C type 1
• MMR
• MMRCD206 antigen
• MRC1

Background

The Mannose Receptor (MR), a member of the vertebrate C-type lectin family, is a pattern recognition receptor that is involved in both innate and adaptive immunity. The 180 kDa transmembrane protein consists of 5 domains: an amino-terminal cysteine-rich region, a fibronectin type II repeat, a series of eight tandem lectin-like carbohydrate recognition domains (responsible for the recognition of mannose and fucose), a transmembrane domain, and an intracellular carboxy-terminal tail.The structure is shared by the family of multi lectin mannose receptors: the phospholipase A2-receptor, DEC 205 and the novel C-type lectin receptor (mannose receptor X). The MR recognises a wide range of gram positive and gram negative bacteria, yeasts, parasites and mycobacteria. The MR has also been shown to bind and internalize tissue-type plasminogen activator. MR's are present on monocytes and dendritic cells (DC) and are presumed to play a role in innate and adaptive immunity, the latter via processing by DC. The expression of MR as observed in immunohistology is present on tissue macrophages, dendritic cells, a subpopulation of endothelial cells, Kupffer cells and sperm cells. The expression of MR on monocytes increases during culture and can be enhanced by cytokines such as IFN-gamma. Labeling of MR expressing monocytes/macrophages increases with prolonged incubation time probably due to internalization of the MR-antibody-complex. The antibody 15-2 prevents binding of glycoproteins including t-PA to MR. Detection of the MR with anti-MR monoclonal antibody 15-2 can substitute staining for mannose containing probes as labeled mannosylated BSA, a technique which is more cumbersome and less specific.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MMR/CD206/Mannose Receptor Antibody (NBP1-90020)(23)

Publications using NBP1-90020

• Li, Xiaonan, X Facile One-Pot Synthesis of Meteor Hammer-like Au-MnOx Nanozymes with Spiky Surface for NIR-II Light-Enhanced Bacterial Elimination Chemistry of Materials 2022-11-22
• Li X, Kempf S, Delgado Lagos F, Ukan Ü et Al. A regulatory loop involving the cytochrome P450-soluble epoxide hydrolase axis and TGF-? signaling iScience 2024-10-14 [PMID: 39398242]
• Liu, C;Zhou, C;Xia, W;Zhou, Y;Qiu, Y;Weng, J;Zhou, Q;Chen, W;Wang, YN;Lee, HH;Wang, SC;Kuang, M;Yu, D;Ren, N;Hung, MC; Targeting ALK averts ribonuclease 1-induced immunosuppression and enhances antitumor immunity in hepatocellular carcinoma Nature communications 2024-02-02 [PMID: 38307859]
• Hyung J, Kim HD, Kim GH et Al. Clinical Outcomes of Small Cell Carcinoma of the Genitourinary Tract and the Prognostic Significance of the Tumor Immune Microenvironment Cancer Res Treat 2024-04-01 [PMID: 38037320]
• McDonald SJ, Bullard BM, VanderVeen BN et al. Emodin reduces surgical wounding-accelerated tumor growth and metastasis via macrophage suppression in a murine triple-negative breast cancer model Physiological reports 2023-10-01 [PMID: 37821408] (IHC-P, Mouse)
  
  Details:
  1:100 dilution
• Dravid A, Dhanabalan K, Naskar S et al. Sustained release Resolvin D1 liposomes are effective in the treatment of osteoarthritis in obese mice bioRxiv 2023-01-23 [PMID: 36773024]
• Kim JH, Kim GH, Ryu YM et al. Clinical implications of the tumor microenvironment using multiplexed immunohistochemistry in patients with advanced or metastatic renal cell carcinoma treated with nivolumab plus ipilimumab Frontiers in Oncology 2022-09-27 [PMID: 36237314] (Immunohistochemistry, Porcine)
• Dravid AA, M Dhanabalan K, Agarwal S, Agarwal R. Resolvin D1-loaded nanoliposomes promote M2 macrophage polarization and are effective in the treatment of osteoarthritis Bioengineering & Translational Medicine 2022-05-01 [PMID: 35600665] (Immunohistochemistry, Porcine)
• Xue L, Deng T, Guo R et al. A Composite Hydrogel Containing Mesoporous Silica Nanoparticles Loaded With Artemisia argyi Extract for Improving Chronic Wound Healing Frontiers in Bioengineering and Biotechnology 2022-03-25 [PMID: 35402406] (Immunohistochemistry, Porcine)
• Kim HD, Kim SY, Kim J et al. Dynamic increase of M2 macrophages is associated with disease progression of colorectal cancers following cetuximab-based treatment Scientific reports 2022-01-31 [PMID: 35102212] (ICC/IF, Human)
• Mou KJ, Shen KF, Li YL et al. Adenosine A2A Receptor in Bone Marrow-Derived Cells Mediated Macrophages M2 Polarization via PPAR gamma-P65 Pathway in Chronic Hypoperfusion Situation Frontiers in aging neuroscience 2022-01-03 [PMID: 35046793] (Immunohistochemistry, Porcine)
• Saadati F, Moritz J, Berner J et al. Patient-Derived Human Basal and Cutaneous Squamous Cell Carcinoma Tissues Display Apoptosis and Immunomodulation following Gas Plasma Exposure with a Certified Argon Jet International Journal of Molecular Sciences 2021-10-23 [PMID: 34768877] (Immunohistochemistry, Porcine)
• Lombardo KA, Obradovic A, Singh AK et al. BCG invokes superior STING-mediated innate immune response over radiotherapy in a carcinogen murine model of urothelial cancer The Journal of Pathology 2022-02-01 [PMID: 34731491] (Immunohistochemistry, Porcine)
• Roy R, Zayas J, Mohamed MF et al. IL-10 Dysregulation Underlies Chemokine Insufficiency, Delayed Macrophage Response, and Impaired Healing in Diabetic Wounds Journal of Investigative Dermatology 2022-03-01 [PMID: 34517005] (Immunohistochemistry, Porcine)
• Davis T, Conradie D, Shridas P et al. Serum amyloid A promotes inflammation-associated damage and tumourigenesis in a mouse model of colitis-associated cancer Cellular and Molecular Gastroenterology and Hepatology 2021-07-01 [PMID: 34217896] (IF/IHC, Mouse)
• Sun G, Cao Y, Qian C et Al. Romo1 is involved in the immune response of glioblastoma by regulating the function of macrophages Aging (Albany NY) 2020-01-16 [PMID: 31945745] (ICC/IF, Mouse)
• HD Dawson, JK Lunney Porcine cluster of differentiation (CD) markers 2018 update Res. Vet. Sci., 2018-02-22;118(0):199-246. 2018-02-22 [PMID: 29518710]
• Siani F, Greco R, Levandis G et al. Influence of Estrogen Modulation on Glia Activation in a Murine Model of Parkinson's Disease. Front Neurosci. 2017-06-16 [PMID: 28620274] (ICC/IF, Mouse)
• Loegl J, Hiden U, Nussbaumer E et al. Hofbauer cells of M2a, M2b and M2c polarization may regulate feto-placental angiogenesis. Reproduction 2016-11-01 [PMID: 27534571] (IF/IHC, Human)
• Pincus SH, Bhaskaran M, Brey RN III et al. Clinical and Pathological Findings Associated with Aerosol Exposure of Macaques to Ricin Toxin. Toxins (Basel) 2015-06-09 [PMID: 26067369] (IF/IHC, Primate)
• Cai Y, Sugimoto C, Arainga M et al. In vivo characterization of alveolar and interstitial lung macrophages in rhesus macaques: Implications for understanding lung disease in humans. J Immunol 2014-03-15 [PMID: 24534529] (ICC/IF, Primate)
• Eirin A, Zhang X, Zhu XY et al. Renal vein cytokine release as an index of renal parenchymal inflammation in chronic experimental renal artery stenosis. Nephrol Dial Transplant 2014-02-01 [PMID: 24097799] (IF/IHC, Porcine)
• Eirin A, Williams BJ, Ebrahimi B et al. Mitochondrial targeted peptides attenuate residual myocardial damage after reversal of experimental renovascular hypertension. J Hypertens 2014-01-01 [PMID: 24048008] (IF/IHC, Porcine)

Review for MMR/CD206/Mannose Receptor Antibody (NBP1-90020) (1)

Average Rating: 4

(Based on 1 review)

We have 1 review tested in 1 species: Mouse.

reviewed by: Verified Customer Flow Mouse 08/09/2019

Summary

• Application: Flow Cytometry
• Sample Tested: Liver
• Species: Mouse
• Lot: K119215

FAQs for MMR/CD206/Mannose Receptor Antibody (NBP1-90020). (Showing 1 - 1 of 1 FAQs).

1. Is this product available for immunofluorescence?
   • NBP1-90020 has only been validated in western blot and IHC on paraffin-embedded tissues. If you would be using fluorescence detection on tissues, it will work for your assay. If you want to use it to detect cells, then note the alternative antibody NBP1-95964 has been validated for immunocytochemistry and may be a better choice for you.

Bioinformatics

• Gene Symbol: MRC1