MMR/CD206/Mannose Receptor Antibody

Images

 
Western Blot: MMR/CD206/Mannose Receptor Antibody [NBP1-90020] - Analysis in human liver tissue.
Independent Antibodies: Immunohistochemistry-Paraffin: MMR/CD206/Mannose Receptor Antibody [NBP1-90020] - Staining of human cerebral cortex, liver, lung and placenta using Anti-MMR/CD206/Mannose Receptor antibody ...read more
Immunohistochemistry-Paraffin: MMR/CD206/Mannose Receptor Antibody [NBP1-90020] - Staining of human cerebral cortex shows no cytoplasmic positivity in neuronal cells.
Immunohistochemistry-Paraffin: MMR/CD206/Mannose Receptor Antibody [NBP1-90020] - Staining of human liver shows moderate cytoplasmic positivity in Kupffer cells.
Immunohistochemistry-Paraffin: MMR/CD206/Mannose Receptor Antibody [NBP1-90020] - Staining of human lung shows moderate to strong cytoplasmic positivity in macrophages.
Immunohistochemistry-Paraffin: MMR/CD206/Mannose Receptor Antibody [NBP1-90020] - Staining of human placenta shows moderate to strong cytoplasmic positivity in Hofbauer cells.
Orthogonal Strategies: Immunohistochemistry-Paraffin: MMR/CD206/Mannose Receptor Antibody [NBP1-90020] - Staining in human lung and cerebral cortex tissues. Corresponding MRC1 RNA-seq data are presented for the ...read more

Product Details

Summary
Reactivity Hu, Mu, Po, PmSpecies Glossary
Applications WB, Flow, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MMR/CD206/Mannose Receptor Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: NEDHKRCVDAVSPSAVQTAACNQDAESQKFRWVSESQIMSVAFKLCLGVPSKTDWVAITLYACDSKSEFQKWECKNDTLLGIKGEDLFFNYGNRQEKNIMLYKGSGLWSRWKIYG
Specificity
Specificity of human MMR/CD206/Mannose Receptor antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MRC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Flow Cytometry
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in ICC/IF reported in scientific literature (PMID 28620274). MMR/CD206/Mannose Receptor antibody validated for Flow from a verified customer review.
Control Peptide
MMR/CD206/Mannose Receptor Protein (NBP1-90020PEP)
Reviewed Applications
Read 1 Review rated 4
using
NBP1-90020 in the following applications:

Publications
Read Publications using
NBP1-90020 in the following applications:

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (86%). Porcine reactivity reported in scientific literature (PMID: 24048008). Mouse reactivity reported in scientific literature (PMID: 28620274). Primate reactivity reported in scientific literature (PMID: 26067369).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MMR/CD206/Mannose Receptor Antibody

  • CD206
  • CLEC13D
  • CLEC13Dmacrophage mannose receptor 1
  • C-type lectin domain family 13 member D
  • mannose receptor, C type 1
  • MMR
  • MMRCD206 antigen
  • MRC1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67381
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-621
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-37537
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-46459
Species: Hu
Applications: WB, IHC, IHC-P, IF
NB200-103
Species: Hu, Mu, Rt, Ch, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-19417
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-09011
Species: Hu
NB100-56546
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-66987
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP2-79843
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, CyTOF-ready
NB100-168
Species: Hu, Mu(-)
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, Flow-IC
NBP2-93743
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90020
Species: Hu, Mu, Po, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for MMR/CD206/Mannose Receptor Antibody (NBP1-90020)(7)

We have publications tested in 4 confirmed species: Human, Mouse, Porcine, Primate.

We have publications tested in 2 applications: ICC/IF, IHC.


Filter By Application
ICC/IF
(3)
IHC
(4)
All Applications
Filter By Species
Human
(1)
Mouse
(2)
Porcine
(2)
Primate
(2)
All Species
Showing Publications 1 - 7 of 7.
Publications using NBP1-90020 Applications Species
Sun G, Cao Y, Qian C et Al. Romo1 is involved in the immune response of glioblastoma by regulating the function of macrophages Aging (Albany NY) Jan 16 2020 [PMID: 31945745] (ICC/IF, Mouse) ICC/IF Mouse
Siani F, Greco R, Levandis G et al. Influence of Estrogen Modulation on Glia Activation in a Murine Model of Parkinson's Disease. Front Neurosci. 2017 Jun 16 [PMID: 28620274] (ICC/IF, Mouse) ICC/IF Mouse
Loegl J, Hiden U, Nussbaumer E et al. Hofbauer cells of M2a, M2b and M2c polarisation may regulate feto-placental angiogenesis. Reproduction. Aug 17 2016 [PMID: 27534571] (IHC, Human) IHC Human
Pincus SH, Bhaskaran M, Brey RN III et al. Clinical and Pathological Findings Associated with Aerosol Exposure of Macaques to Ricin Toxin. Toxins (Basel) 2015 Jun 9 [PMID: 26067369] (IHC, Primate) IHC Primate
Cai Y, Sugimoto C, Arainga M et al. In vivo characterization of alveolar and interstitial lung macrophages in rhesus macaques: Implications for understanding lung disease in humans. J Immunol 2014 Mar 15 [PMID: 24534529] (ICC/IF, Primate) ICC/IF Primate
Eirin A, Zhang X, Zhu XY et al. Renal vein cytokine release as an index of renal parenchymal inflammation in chronic experimental renal artery stenosis. Nephrol Dial Transplant 2014 Feb [PMID: 24097799] (IHC, Porcine) IHC Porcine
Eirin A, Williams BJ, Ebrahimi B et al. Mitochondrial targeted peptides attenuate residual myocardial damage after reversal of experimental renovascular hypertension. J Hypertens 2014 Jan [PMID: 24048008] (IHC, Porcine) IHC Porcine

Review for MMR/CD206/Mannose Receptor Antibody (NBP1-90020) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using NBP1-90020:
Filter by Applications
Flow
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Flow Cytometry MMR/CD206/Mannose Receptor NBP1-90020
Enlarge
reviewed by:
Anonymous
Flow Mouse 08/09/2019
View

Summary

ApplicationFlow Cytometry
Sample TestedLiver
SpeciesMouse
LotK119215

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MMR/CD206/Mannose Receptor Antibody (NBP1-90020). (Showing 1 - 1 of 1 FAQs).

  1. Is this product available for immunofluorescence?
    • NBP1-90020 has only been validated in western blot and IHC on paraffin-embedded tissues. If you would be using fluorescence detection on tissues, it will work for your assay. If you want to use it to detect cells, then note the alternative antibody NBP1-95964 has been validated for immunocytochemistry and may be a better choice for you.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MMR/CD206/Mannose Receptor Products

Bioinformatics Tool for MMR/CD206/Mannose Receptor Antibody (NBP1-90020)

Discover related pathways, diseases and genes to MMR/CD206/Mannose Receptor Antibody (NBP1-90020). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MMR/CD206/Mannose Receptor Antibody (NBP1-90020)

Discover more about diseases related to MMR/CD206/Mannose Receptor Antibody (NBP1-90020).
 

Pathways for MMR/CD206/Mannose Receptor Antibody (NBP1-90020)

View related products by pathway.

PTMs for MMR/CD206/Mannose Receptor Antibody (NBP1-90020)

Learn more about PTMs related to MMR/CD206/Mannose Receptor Antibody (NBP1-90020).

Blogs on MMR/CD206/Mannose Receptor

There are no specific blogs for MMR/CD206/Mannose Receptor, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Anonymous
08/09/2019
Application: Flow
Species: Mouse

Bioinformatics

Gene Symbol MRC1