MMR/CD206/Mannose Receptor Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: MMR/CD206/Mannose Receptor Antibody [NBP1-90020] - Staining in human lung and cerebral cortex tissues. Corresponding MRC1 RNA-seq data are presented for the ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: MMR/CD206/Mannose Receptor Antibody [NBP1-90020] - Staining of human cerebral cortex, liver, lung and placenta using Anti-MMR/CD206/Mannose Receptor antibody ...read more
Western Blot: MMR/CD206/Mannose Receptor Antibody [NBP1-90020] - Analysis in human liver tissue.
Immunohistochemistry-Paraffin: MMR/CD206/Mannose Receptor Antibody [NBP1-90020] - Staining of human cerebral cortex shows no cytoplasmic positivity in neuronal cells.
Immunohistochemistry-Paraffin: MMR/CD206/Mannose Receptor Antibody [NBP1-90020] - Staining of human liver shows moderate cytoplasmic positivity in Kupffer cells.
Immunohistochemistry-Paraffin: MMR/CD206/Mannose Receptor Antibody [NBP1-90020] - Staining of human lung shows moderate to strong cytoplasmic positivity in macrophages.
Immunohistochemistry-Paraffin: MMR/CD206/Mannose Receptor Antibody [NBP1-90020] - Staining of human placenta shows moderate to strong cytoplasmic positivity in Hofbauer cells.

Product Details

Summary
Reactivity Hu, Mu, Po, PmSpecies Glossary
Applications WB, Flow, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MMR/CD206/Mannose Receptor Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: NEDHKRCVDAVSPSAVQTAACNQDAESQKFRWVSESQIMSVAFKLCLGVPSKTDWVAITLYACDSKSEFQKWECKNDTLLGIKGEDLFFNYGNRQEKNIMLYKGSGLWSRWKIYG
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MRC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Flow Cytometry
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in ICC/IF reported in scientific literature (PMID 28620274). MMR/CD206/Mannose Receptor antibody validated for Flow from a verified customer review.
Control Peptide
MMR/CD206/Mannose Receptor Protein (NBP1-90020PEP)
Reviewed Applications
Read 1 Review rated 4
using
NBP1-90020 in the following applications:

Publications
Read Publications using
NBP1-90020 in the following applications:

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (86%). Porcine reactivity reported in scientific literature (PMID: 24048008). Mouse reactivity reported in scientific literature (PMID: 28620274). Primate reactivity reported in scientific literature (PMID: 26067369).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MMR/CD206/Mannose Receptor Antibody

  • CD206
  • CLEC13D
  • CLEC13Dmacrophage mannose receptor 1
  • C-type lectin domain family 13 member D
  • mannose receptor, C type 1
  • MMR
  • MMRCD206 antigen
  • MRC1

Background

The Mannose Receptor (MR), a member of the vertebrate C-type lectin family, is a pattern recognition receptor that is involved in both innate and adaptive immunity. The 180 kDa transmembrane protein consists of 5 domains: an amino-terminal cysteine-rich region, a fibronectin type II repeat, a series of eight tandem lectin-like carbohydrate recognition domains (responsible for the recognition of mannose and fucose), a transmembrane domain, and an intracellular carboxy-terminal tail.The structure is shared by the family of multi lectin mannose receptors: the phospholipase A2-receptor, DEC 205 and the novel C-type lectin receptor (mannose receptor X). The MR recognises a wide range of gram positive and gram negative bacteria, yeasts, parasites and mycobacteria. The MR has also been shown to bind and internalize tissue-type plasminogen activator. MR's are present on monocytes and dendritic cells (DC) and are presumed to play a role in innate and adaptive immunity, the latter via processing by DC. The expression of MR as observed in immunohistology is present on tissue macrophages, dendritic cells, a subpopulation of endothelial cells, Kupffer cells and sperm cells. The expression of MR on monocytes increases during culture and can be enhanced by cytokines such as IFN-gamma. Labeling of MR expressing monocytes/macrophages increases with prolonged incubation time probably due to internalization of the MR-antibody-complex. The antibody 15-2 prevents binding of glycoproteins including t-PA to MR. Detection of the MR with anti-MR monoclonal antibody 15-2 can substitute staining for mannose containing probes as labeled mannosylated BSA, a technique which is more cumbersome and less specific.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67381
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
NBP3-07211
Species: Ca, Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-83319
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-46459
Species: Hu
Applications: ICC/IF, IF, IHC, IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-19417
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-13739
Species: Hu
Applications: ELISA, Flow, ICC/IF, IP, PA
AF1626
Species: Hu
Applications: ICC, WB
DY417
Species: Mu
Applications: ELISA
NB100-91662
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
210-TA
Species: Hu
Applications: BA
6507-IL/CF
Species: Hu
Applications: BA
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-86509
Species: Hu
Applications: IHC, IHC-P
NB500-106
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
7268-CT
Species: Hu
Applications: BA
NB100-168
Species: Hu, Mu(-)
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-93743
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP1-90020
Species: Hu, Mu, Po, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for MMR/CD206/Mannose Receptor Antibody (NBP1-90020)(9)

We have publications tested in 4 confirmed species: Human, Mouse, Porcine, Primate.

We have publications tested in 2 applications: ICC/IF, IHC.


Filter By Application
ICC/IF
(4)
IHC
(5)
All Applications
Filter By Species
Human
(2)
Mouse
(3)
Porcine
(2)
Primate
(2)
All Species
Showing Publications 1 - 9 of 9.
Publications using NBP1-90020 Applications Species
Kim HD, Kim SY, Kim J et al. Dynamic increase of M2 macrophages is associated with disease progression of colorectal cancers following cetuximab-based treatment Scientific reports Jan 31 2022 [PMID: 35102212] (ICC/IF, Human) ICC/IF Human
Davis T, Conradie D, Shridas P et al. Serum amyloid A promotes inflammation-associated damage and tumourigenesis in a mouse model of colitis-associated cancer Cellular and Molecular Gastroenterology and Hepatology Jul 1 2021 [PMID: 34217896] (IHC, Mouse) IHC Mouse
Sun G, Cao Y, Qian C et Al. Romo1 is involved in the immune response of glioblastoma by regulating the function of macrophages Aging (Albany NY) Jan 16 2020 [PMID: 31945745] (ICC/IF, Mouse) ICC/IF Mouse
Siani F, Greco R, Levandis G et al. Influence of Estrogen Modulation on Glia Activation in a Murine Model of Parkinson's Disease. Front Neurosci. 2017 Jun 16 [PMID: 28620274] (ICC/IF, Mouse) ICC/IF Mouse
Loegl J, Hiden U, Nussbaumer E et al. Hofbauer cells of M2a, M2b and M2c polarisation may regulate feto-placental angiogenesis. Reproduction. Aug 17 2016 [PMID: 27534571] (IHC, Human) IHC Human
Pincus SH, Bhaskaran M, Brey RN III et al. Clinical and Pathological Findings Associated with Aerosol Exposure of Macaques to Ricin Toxin. Toxins (Basel) 2015 Jun 9 [PMID: 26067369] (IHC, Primate) IHC Primate
Cai Y, Sugimoto C, Arainga M et al. In vivo characterization of alveolar and interstitial lung macrophages in rhesus macaques: Implications for understanding lung disease in humans. J Immunol 2014 Mar 15 [PMID: 24534529] (ICC/IF, Primate) ICC/IF Primate
Eirin A, Zhang X, Zhu XY et al. Renal vein cytokine release as an index of renal parenchymal inflammation in chronic experimental renal artery stenosis. Nephrol Dial Transplant 2014 Feb [PMID: 24097799] (IHC, Porcine) IHC Porcine
Eirin A, Williams BJ, Ebrahimi B et al. Mitochondrial targeted peptides attenuate residual myocardial damage after reversal of experimental renovascular hypertension. J Hypertens 2014 Jan [PMID: 24048008] (IHC, Porcine) IHC Porcine

Review for MMR/CD206/Mannose Receptor Antibody (NBP1-90020) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using NBP1-90020:
Filter by Applications
Flow
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Flow Cytometry MMR/CD206/Mannose Receptor NBP1-90020
Enlarge
4
reviewed by:
Mozhdeh Sojoodi
Flow Mouse 08/09/2019
View

Summary

ApplicationFlow Cytometry
Sample TestedLiver
SpeciesMouse
LotK119215

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MMR/CD206/Mannose Receptor Antibody (NBP1-90020). (Showing 1 - 1 of 1 FAQs).

  1. Is this product available for immunofluorescence?
    • NBP1-90020 has only been validated in western blot and IHC on paraffin-embedded tissues. If you would be using fluorescence detection on tissues, it will work for your assay. If you want to use it to detect cells, then note the alternative antibody NBP1-95964 has been validated for immunocytochemistry and may be a better choice for you.

Secondary Antibodies

 

Isotype Controls

Additional MMR/CD206/Mannose Receptor Products

Bioinformatics Tool for MMR/CD206/Mannose Receptor Antibody (NBP1-90020)

Discover related pathways, diseases and genes to MMR/CD206/Mannose Receptor Antibody (NBP1-90020). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MMR/CD206/Mannose Receptor Antibody (NBP1-90020)

Discover more about diseases related to MMR/CD206/Mannose Receptor Antibody (NBP1-90020).
 

Pathways for MMR/CD206/Mannose Receptor Antibody (NBP1-90020)

View related products by pathway.

PTMs for MMR/CD206/Mannose Receptor Antibody (NBP1-90020)

Learn more about PTMs related to MMR/CD206/Mannose Receptor Antibody (NBP1-90020).
 

Research Areas for MMR/CD206/Mannose Receptor Antibody (NBP1-90020)

Find related products by research area.

Blogs on MMR/CD206/Mannose Receptor.

Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Mozhdeh Sojoodi
08/09/2019
Application: Flow
Species: Mouse

Bioinformatics

Gene Symbol MRC1