MMR/CD206/Mannose Receptor Antibody

Images

 
Western Blot: MMR/CD206/Mannose Receptor Antibody [NBP1-90020] - Analysis in human liver tissue.
Immunohistochemistry-Paraffin: MMR/CD206/Mannose Receptor Antibody [NBP1-90020] - Staining of human cerebral cortex shows no cytoplasmic positivity in neuronal cells.
Immunohistochemistry-Paraffin: MMR/CD206/Mannose Receptor Antibody [NBP1-90020] - Staining of human lung shows moderate to strong cytoplasmic positivity in macrophages.
Immunohistochemistry-Paraffin: MMR/CD206/Mannose Receptor Antibody [NBP1-90020] - Staining of human placenta shows moderate to strong cytoplasmic positivity in Hofbauer cells.
Immunohistochemistry-Paraffin: MMR/CD206/Mannose Receptor Antibody [NBP1-90020] - Staining of human liver shows moderate cytoplasmic positivity in Kupffer cells.

Product Details

Summary
Reactivity Hu, Mu, PoSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MMR/CD206/Mannose Receptor Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NEDHKRCVDAVSPSAVQTAACNQDAESQKFRWVSESQIMSVAFKLCLGVPSKTDWVAITLYACDSKSEFQKWECKNDTLLGIKGEDLFFNYGNRQEKNIMLYKGSGLWSRWKIYG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MRC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in Immunocytochemistry/immunofluorescence reported in scientific literature (PMID 28620274).
Control Peptide
MMR/CD206/Mannose Receptor Protein (NBP1-90020PEP)
Publications
Read Publications using
NBP1-90020 in the following applications:

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (86%). Porcine reactivity reported in scientific literature (PMID: 24048008). Mouse reactivity reported in scientific literature (PMID: 28620274).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MMR/CD206/Mannose Receptor Antibody

  • CD206
  • CLEC13D
  • CLEC13Dmacrophage mannose receptor 1
  • C-type lectin domain family 13 member D
  • mannose receptor, C type 1
  • MMR
  • MMRCD206 antigen
  • MRC1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56552
Species: Hu
Applications: WB
NB100-621
Species: Hu, Mu
Applications: WB, IHC-P, IP
NB100-329
Species: Hu
Applications: WB, IHC, IP, PLA, RIA
NB100-56554
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P, CyTOF-ready
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-19417
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58368
Species: Hu
Applications: ICC/IF
NB100-56546
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF4885
Species: Mu
Applications: WB, IP
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-168
Species: Hu, Mu(-)
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, Flow-IC
NBP1-88968
Species: Hu
Applications: WB, IHC, IHC-P

Publications for MMR/CD206/Mannose Receptor Antibody (NBP1-90020)(6)

We have publications tested in 4 confirmed species: Human, Mouse, Porcine, Primate.

We have publications tested in 2 applications: ICC/IF, IHC.


Filter By Application
ICC/IF
(2)
IHC
(4)
All Applications
Filter By Species
Human
(1)
Mouse
(1)
Porcine
(2)
Primate
(2)
All Species

Reviews for MMR/CD206/Mannose Receptor Antibody (NBP1-90020) (0)

There are no reviews for MMR/CD206/Mannose Receptor Antibody (NBP1-90020). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MMR/CD206/Mannose Receptor Antibody (NBP1-90020). (Showing 1 - 1 of 1 FAQs).

  1. Is this product available for immunofluorescence?
    • NBP1-90020 has only been validated in western blot and IHC on paraffin-embedded tissues. If you would be using fluorescence detection on tissues, it will work for your assay. If you want to use it to detect cells, then note the alternative antibody NBP1-95964 has been validated for immunocytochemistry and may be a better choice for you.

Secondary Antibodies

 

Isotype Controls

Additional MMR/CD206/Mannose Receptor Products

Bioinformatics Tool for MMR/CD206/Mannose Receptor Antibody (NBP1-90020)

Discover related pathways, diseases and genes to MMR/CD206/Mannose Receptor Antibody (NBP1-90020). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MMR/CD206/Mannose Receptor Antibody (NBP1-90020)

Discover more about diseases related to MMR/CD206/Mannose Receptor Antibody (NBP1-90020).
 

Pathways for MMR/CD206/Mannose Receptor Antibody (NBP1-90020)

View related products by pathway.

PTMs for MMR/CD206/Mannose Receptor Antibody (NBP1-90020)

Learn more about PTMs related to MMR/CD206/Mannose Receptor Antibody (NBP1-90020).

Blogs on MMR/CD206/Mannose Receptor

There are no specific blogs for MMR/CD206/Mannose Receptor, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MMR/CD206/Mannose Receptor Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MRC1
Entrez