Independent Antibodies: Immunohistochemistry-Paraffin: MMR/CD206/Mannose Receptor Antibody [NBP1-90020] - Staining of human cerebral cortex, liver, lung and placenta using Anti-MMR/CD206/Mannose Receptor antibody ...read more
Orthogonal Strategies: Analysis in human lung and cerebral cortex tissues using NBP1-90020 antibody. Corresponding MRC1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: MMR/CD206/Mannose Receptor Antibody [NBP1-90020] - Staining of human lung shows moderate to strong cytoplasmic positivity in macrophages.
Immunohistochemistry-Paraffin: MMR/CD206/Mannose Receptor Antibody [NBP1-90020] - Staining of human cerebral cortex shows no cytoplasmic positivity in neuronal cells.
Immunohistochemistry-Paraffin: MMR/CD206/Mannose Receptor Antibody [NBP1-90020] - Staining of human liver shows moderate cytoplasmic positivity in Kupffer cells.
Immunohistochemistry-Paraffin: MMR/CD206/Mannose Receptor Antibody [NBP1-90020] - Staining of human placenta shows moderate to strong cytoplasmic positivity in Hofbauer cells.
Analysis in human liver tissue.
Dynamic changes of the density of the M2 macrophages according to different clinical settings. (A) Representative scans of multiplexed immunohistochemistry showing dynamic changes of CD68, CD206 and PD-L1 between ...read more
This antibody was developed against Recombinant Protein corresponding to amino acids: NEDHKRCVDAVSPSAVQTAACNQDAESQKFRWVSESQIMSVAFKLCLGVPSKTDWVAITLYACDSKSEFQKWECKNDTLLGIKGEDLFFNYGNRQEKNIMLYKGSGLWSRWKIYG
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MRC1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Immunogen displays the following percentage of sequence identity for non-tested species: Rat (86%), Mouse (84).
Packaging, Storage & Formulations
Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified
Alternate Names for MMR/CD206/Mannose Receptor Antibody - BSA Free
CD206
CLEC13D
CLEC13Dmacrophage mannose receptor 1
C-type lectin domain family 13 member D
mannose receptor, C type 1
MMR
MMRCD206 antigen
MRC1
Background
The Mannose Receptor (MR), a member of the vertebrate C-type lectin family, is a pattern recognition receptor that is involved in both innate and adaptive immunity. The 180 kDa transmembrane protein consists of 5 domains: an amino-terminal cysteine-rich region, a fibronectin type II repeat, a series of eight tandem lectin-like carbohydrate recognition domains (responsible for the recognition of mannose and fucose), a transmembrane domain, and an intracellular carboxy-terminal tail.The structure is shared by the family of multi lectin mannose receptors: the phospholipase A2-receptor, DEC 205 and the novel C-type lectin receptor (mannose receptor X). The MR recognises a wide range of gram positive and gram negative bacteria, yeasts, parasites and mycobacteria. The MR has also been shown to bind and internalize tissue-type plasminogen activator. MR's are present on monocytes and dendritic cells (DC) and are presumed to play a role in innate and adaptive immunity, the latter via processing by DC. The expression of MR as observed in immunohistology is present on tissue macrophages, dendritic cells, a subpopulation of endothelial cells, Kupffer cells and sperm cells. The expression of MR on monocytes increases during culture and can be enhanced by cytokines such as IFN-gamma. Labeling of MR expressing monocytes/macrophages increases with prolonged incubation time probably due to internalization of the MR-antibody-complex. The antibody 15-2 prevents binding of glycoproteins including t-PA to MR. Detection of the MR with anti-MR monoclonal antibody 15-2 can substitute staining for mannose containing probes as labeled mannosylated BSA, a technique which is more cumbersome and less specific.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Li, Xiaonan, X Facile One-Pot Synthesis of Meteor Hammer-like Au-MnOx Nanozymes with Spiky Surface for NIR-II Light-Enhanced Bacterial Elimination Chemistry of Materials 2022-11-22
FAQs for MMR/CD206/Mannose Receptor Antibody (NBP1-90020). (Showing 1 - 1 of 1 FAQs).
Is this product available for immunofluorescence?
NBP1-90020 has only been validated in western blot and IHC on paraffin-embedded tissues. If you would be using fluorescence detection on tissues, it will work for your assay. If you want to use it to detect cells, then note the alternative antibody NBP1-95964 has been validated for immunocytochemistry and may be a better choice for you.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.