BRD1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: BRD1 Antibody [NBP1-88351] - Staining of human cell line U-251MG shows positivity in nucleus.
Immunohistochemistry-Paraffin: BRD1 Antibody [NBP1-88351] - Staining of human testis shows moderate nuclear positivity in seminiferus ducts.
Immunocytochemistry/ Immunofluorescence: BRD1 Antibody [NBP1-88351] - Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear speckles.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BRD1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:IAAEVGQSSMWISTDAAASVLEPLKVVWAKCSGYPSYPALIIDPKMPRVPGHHNGVTIPAPPLDVLKIGEHMQTKSDEKLFLVLFFDNKRSWQWLPKSKMVPLGIDETIDKLKMMEGRNSSIRKAVRIAFDRAMNHLSRVHGEPTSD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BRD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
BRD1 Protein (NBP1-88351PEP)
Publications
Read Publication using NBP1-88351.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 22412953)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BRD1 Antibody

  • bromodomain containing 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB600-930
Species: Hu, Ba
Applications: WB, ELISA
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-57745
Species: Hu
Applications: ICC/IF, IHC-P
NBP1-80324
Species: Hu
Applications: WB
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
MAB6534
Species: Hu
Applications: WB, ELISA
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
MAB1233
Species: Hu
Applications: Flow, IP, CyTOF-ready, ICC
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-44501
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, IF
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-88351
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for BRD1 Antibody (NBP1-88351)(1)

Reviews for BRD1 Antibody (NBP1-88351) (0)

There are no reviews for BRD1 Antibody (NBP1-88351). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for BRD1 Antibody (NBP1-88351) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BRD1 Products

Bioinformatics Tool for BRD1 Antibody (NBP1-88351)

Discover related pathways, diseases and genes to BRD1 Antibody (NBP1-88351). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BRD1 Antibody (NBP1-88351)

Discover more about diseases related to BRD1 Antibody (NBP1-88351).
 

Pathways for BRD1 Antibody (NBP1-88351)

View related products by pathway.

PTMs for BRD1 Antibody (NBP1-88351)

Learn more about PTMs related to BRD1 Antibody (NBP1-88351).

Blogs on BRD1

There are no specific blogs for BRD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BRD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BRD1