MLF2 Antibody (2F6-1E3)

Images

 
Western Blot: MLF2 Antibody (2F6-1E3) [H00008079-M01] - Analysis of MLF2 expression in transfected 293T cell line by MLF2 monoclonal antibody (M01), clone 2F6-1E3.Lane 1: MLF2 transfected lysate(27.28 KDa).Lane 2: ...read more
Immunohistochemistry-Paraffin: MLF2 Antibody (2F6-1E3) [H00008079-M01] - Analysis of monoclonal antibody to MLF2 on formalin-fixed paraffin-embedded human pancreas. Antibody concentration 3 ug/ml.
Sandwich ELISA: MLF2 Antibody (2F6-1E3) [H00008079-M01] - Detection limit for recombinant GST tagged MLF2 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC-P
Clone
2F6-1E3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

MLF2 Antibody (2F6-1E3) Summary

Immunogen
MLF2 (AAH00898, 1 a.a. - 248 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MFRFMRDVEPEDPMFLMDPFAIHRQHMSRMLSGGFGYSPFLSITDGNMPGTRPASRRMQQAGAVSPFGMLGMSGGFMDMFGMMNDMIGNMEHMTAGGNCQTFSSSTVISYSNTGDGAPKVYQETSEMRSAPGGIRETRRTVRDSDSGLEQMSIGHHIRDRAHILQRSRNHRTGDQEERQDYINLDESEAAAFDDEWRRETSRFRQQRPLEFRRLESSGAGGRRAEGPPRLAIQGPEDSPSRQSRRYDW
Specificity
MLF2 - myeloid leukemia factor 2
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MLF2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for IHC-P and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MLF2 Antibody (2F6-1E3)

  • Myelodysplasia-myeloid leukemia factor 2
  • myeloid leukemia factor 2
  • NTN4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1132
Species: Mu
Applications: WB, IHC, Block
AF1006
Species: Rt
Applications: WB, IHC
AF1079
Species: Hu, Mu
Applications: WB, Simple Western, IHC, Block
NBP2-02052
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF844
Species: Mu
Applications: WB, Block
NB110-61646
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
AF3629
Species: Hu, Mu, Rt
Applications: WB, Neut
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-76798
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF1005
Species: Hu
Applications: WB, IHC
NB300-619
Species: Hu, Mu, Rt, Bv, Ch, Ha
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
6514-SL
Species: Hu
H00005956-R02
Species: Hu
NBP1-83162
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MLF2 Antibody (H00008079-M01) (0)

There are no publications for MLF2 Antibody (H00008079-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MLF2 Antibody (H00008079-M01) (0)

There are no reviews for MLF2 Antibody (H00008079-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MLF2 Antibody (H00008079-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MLF2 Products

Bioinformatics Tool for MLF2 Antibody (H00008079-M01)

Discover related pathways, diseases and genes to MLF2 Antibody (H00008079-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MLF2 Antibody (H00008079-M01)

Discover more about diseases related to MLF2 Antibody (H00008079-M01).
 

Pathways for MLF2 Antibody (H00008079-M01)

View related products by pathway.

Research Areas for MLF2 Antibody (H00008079-M01)

Find related products by research area.

Blogs on MLF2

There are no specific blogs for MLF2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MLF2 Antibody (2F6-1E3) and receive a gift card or discount.

Bioinformatics

Gene Symbol MLF2
Entrez
OMIM
Uniprot