MLC1 Antibody

Images

 
Western Blot: MLC1 Antibody [NBP1-80073] - Titration: 0.2-1 ug/ml, Positive Control: Human Spleen.
Immunohistochemistry-Paraffin: MLC1 Antibody [NBP1-80073] - Rat Astrocytes, 20 ug/ml.
Western Blot: MLC1 Antibody [NBP1-80073] - Human Fetal Spleen, Antibody Dilution: 1.0 ug/ml.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MLC1 Antibody Summary

Immunogen
Synthetic peptide directed towards the middle region of human MLC1. Peptide sequence SDSANILDEVPFPARVLKSYSVVEVIAGISAVLGGIIALNVDDSVSGPHL.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MLC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against MLC1 and was validated on Western blot.
Theoretical MW
41 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MLC1 Antibody

  • LVM
  • megalencephalic leukoencephalopathy with subcortical cysts 1
  • WKL1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34252
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP1-86613
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86648
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87744
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
H00085366-M01
Species: Hu, Mu
Applications: WB, ELISA, RNAi
H00003930-B01P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
NB110-38889
Species: Hu
Applications: WB, IP
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP1-84168
Species: Hu
Applications: IHC, IHC-P

Publications for MLC1 Antibody (NBP1-80073) (0)

There are no publications for MLC1 Antibody (NBP1-80073).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MLC1 Antibody (NBP1-80073) (0)

There are no reviews for MLC1 Antibody (NBP1-80073). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MLC1 Antibody (NBP1-80073) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MLC1 Products

Bioinformatics Tool for MLC1 Antibody (NBP1-80073)

Discover related pathways, diseases and genes to MLC1 Antibody (NBP1-80073). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MLC1 Antibody (NBP1-80073)

Discover more about diseases related to MLC1 Antibody (NBP1-80073).
 

Pathways for MLC1 Antibody (NBP1-80073)

View related products by pathway.

PTMs for MLC1 Antibody (NBP1-80073)

Learn more about PTMs related to MLC1 Antibody (NBP1-80073).

Blogs on MLC1

There are no specific blogs for MLC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MLC1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MLC1
Uniprot