MLC1 Antibody


Western Blot: MLC1 Antibody [NBP1-80073] - Titration: 0.2-1 ug/ml, Positive Control: Human Spleen.
Immunohistochemistry-Paraffin: MLC1 Antibody [NBP1-80073] - Rat Astrocytes, 20 ug/ml.
Western Blot: MLC1 Antibody [NBP1-80073] - Human Fetal Spleen, Antibody Dilution: 1.0 ug/ml.

Product Details

Reactivity Hu, RtSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

MLC1 Antibody Summary

Synthetic peptide directed towards the middle region of human MLC1. Peptide sequence SDSANILDEVPFPARVLKSYSVVEVIAGISAVLGGIIALNVDDSVSGPHL.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.2-1 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against MLC1 and was validated on Western blot.
Theoretical MW
41 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MLC1 Antibody

  • LVM
  • megalencephalic leukoencephalopathy with subcortical cysts 1
  • WKL1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N, CyTOF-ready, Flow-IC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
Species: Hu
Applications: WB, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Multi
Applications: WB, IHC, ICC
Species: Hu
Applications: IHC, IHC-P

Publications for MLC1 Antibody (NBP1-80073) (0)

There are no publications for MLC1 Antibody (NBP1-80073).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MLC1 Antibody (NBP1-80073) (0)

There are no reviews for MLC1 Antibody (NBP1-80073). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MLC1 Antibody (NBP1-80073) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for MLC1 Antibody (NBP1-80073)

Discover related pathways, diseases and genes to MLC1 Antibody (NBP1-80073). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MLC1 Antibody (NBP1-80073)

Discover more about diseases related to MLC1 Antibody (NBP1-80073).

Pathways for MLC1 Antibody (NBP1-80073)

View related products by pathway.

PTMs for MLC1 Antibody (NBP1-80073)

Learn more about PTMs related to MLC1 Antibody (NBP1-80073).

Blogs on MLC1

There are no specific blogs for MLC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MLC1 Antibody and receive a gift card or discount.


Gene Symbol MLC1