MKK4/MEK4 Antibody - BSA Free

Western Blot: MKK4/MEK4 Antibody [NBP2-57194] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.

Immunocytochemistry/Immunofluorescence: MKK4/MEK4 Antibody [NBP2-57194] - Staining of human cell line HEK 293 shows localization to nucleoplasm & cell junctions. Antibody staining is shown in green.

• Reactivity: Hu, Mu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MKK4/MEK4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MKK4/MEK4 Antibody - BSA Free (NBP2-57194) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PAVSSMQGKRKALKLNFANPPFKSTARFTLNPNPTGVQNPHIERLRTHSIESSGKLKISPEQHWDFTAEDLKDLGEI
• Predicted Species: Mouse (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MAP2K4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  MKK4/MEK4 Recombinant Protein Antigen (NBP2-57194PEP)

Reactivity Notes

Rat 88%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for MKK4/MEK4 Antibody - BSA Free

• c-Jun N-terminal kinase kinase 1
• dual specificity mitogen-activated protein kinase kinase 4
• JNK activating kinase 1
• JNK-activated kinase 1
• JNK-activating kinase 1
• JNKK
• JNKK1
• JNKK1MAPK/ERK kinase 4
• MAP kinase kinase 4
• MAP2K4
• MAPKK4
• MEK4
• MEK4MEK 4
• mitogen-activated protein kinase kinase 4
• MKK4
• MKK4SAPK/ERK kinase 1
• PRKMK4
• PRKMK4MAPKK 4
• SEK1
• SERK1
• SERK1EC 2.7.12.2

Background

MKK4, also known as JNKK1 and SEK1, is a dual specificity kinase that belongs to the Ser/Thr protein kinase family. MKK4 is a direct activator of MAP kinases in response to various environmental stresses or mitogenic stimuli. MKK4 phosphorylates and activates p38 MAP kinase and JNK but not ERK 1/2 (1-2). JNK is activated by dual phosphorylation at Thr and Tyr by MKK4 and MKK7; although MKK4 will preferentially phosphorylate Tyr (3). MKK4 is also known to be a tumor suppressor, as mutations inactivating the MKK4 gene have been found in 5% of a wide variety of tumor types (4).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MAP2K4