MIXL1 Antibody - Azide and BSA Free Summary
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 150-232 of human MIXL1 (NP_114150.1). QPLARPEIILNHCAPGTETKCLKPQLPLEVDVNCLPEPNGVGGGISDSSSQGQNFETCSPLSEDIGSKLDSWEEHIFSAFGNF |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
MIXL1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Western Blot 1:500-1:2000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.01% Thimerosal |
| Purity |
Affinity purified |
Alternate Names for MIXL1 Antibody - Azide and BSA Free
Background
MIXL1, also known as Homeobox protein MIXL1, is a 232 amino acid protein that is 25 kDa, restricted to progenitors and secondary lymph tissues, acts as an important transcription factor in proper axial mesendoderm morphogenesis and endoderm formation, needed for efficient differentiation of cells from the primitive streak stage to blood by acting early in the recruitment and/or expansion of mesodermal progenitors to the hemangioblastic and hematopoietic lineages, participates in the morphogenesis of the heart and the gut during embryogenesis, and acts as a negative regulator of brachyury expression. Studies of this protein are being performed on research about uterine inversion, vascular dementia, Hodgkin's lymphoma, dementia, cholera, and hematopoiesis. OMA1 protein has been shown to interact with ALX4, DLX1, GTF2E1, IRF9, NEUROD1, NKX2-1, POU4F2, and TLE6 proteins in adipogenesis pathway and endoderm formation, hematopoietic progenitor cell differentiation, transcription, DNA-dependent, gastrulation, endoderm development, heart development, and digestive tract development processes.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA, BA
Species: Mu
Applications: ELISA
Species: Hu, Mu
Applications: IHC-P, WB
Species: Hu
Applications: ICC, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: ChIP, ICC, IHC, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu
Applications: ICC, IHC, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow, KO, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Ch, Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov
Publications for MIXL1 Antibody (NBP3-04159) (0)
There are no publications for MIXL1 Antibody (NBP3-04159).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MIXL1 Antibody (NBP3-04159) (0)
There are no reviews for MIXL1 Antibody (NBP3-04159).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for MIXL1 Antibody (NBP3-04159) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional MIXL1 Products
Research Areas for MIXL1 Antibody (NBP3-04159)
Find related products by research area.
|
Blogs on MIXL1