Mindin/Spondin-2 Antibody

Images

 
Western Blot: Mindin/Spondin-2 Antibody [NBP2-57815] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma and human liver tissue.
Immunocytochemistry/ Immunofluorescence: Mindin/Spondin-2 Antibody [NBP2-57815] - Staining of human cell line HaCaT shows localization to vesicles.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Mindin/Spondin-2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: HSLVSFVVRIVPSPDWFVGVDSLDLCDGDRWREQAALDLYPYDAGTDSGFTFSSPNFATIPQDTVTEITSSSP
Specificity
Specificity of human Mindin/Spondin-2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SPON2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Mindin/Spondin-2 Recombinant Protein Antigen (NBP2-57815PEP)

Reactivity Notes

Mouse 89%, Rat 89%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Mindin/Spondin-2 Antibody

  • Differentially expressed in cancerous and non-cancerous lung cells 1
  • DIL1
  • DIL-1
  • DIL1FLJ34460
  • DKFZp686G21139
  • FLJ16313
  • FLJ22401
  • Mindin
  • M-SPONDIN
  • RG-1
  • SPON2
  • Spondin 2
  • spondin 2, extracellular matrix protein
  • spondin-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3135
Species: Hu
Applications: WB, Simple Western, Neut
AF2154
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready
NB500-179
Species: Hu, Mu, Rt, Po, Ma
Applications: WB, Simple Western, Flow, ICC/IF, IP, KD
AF3928
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, KO
NB600-1468
Species: Hu
Applications: WB, S-ELISA
NB100-56603
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), ICC, Neut, ELISA(Sta)
NBP2-22106
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
AF4036
Species: Hu
Applications: WB, Simple Western
NBP1-32920
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13669
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-25255
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
H00005324-M02
Species: Hu, Mu
Applications: WB, ChIP, ELISA, IHC, IHC-P, S-ELISA
H00004830-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA
NBP2-12555
Species: Hu
NBP2-14040
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Mindin/Spondin-2 Antibody (NBP2-57815) (0)

There are no publications for Mindin/Spondin-2 Antibody (NBP2-57815).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Mindin/Spondin-2 Antibody (NBP2-57815) (0)

There are no reviews for Mindin/Spondin-2 Antibody (NBP2-57815). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Mindin/Spondin-2 Antibody (NBP2-57815) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Mindin/Spondin-2 Products

Bioinformatics Tool for Mindin/Spondin-2 Antibody (NBP2-57815)

Discover related pathways, diseases and genes to Mindin/Spondin-2 Antibody (NBP2-57815). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Mindin/Spondin-2 Antibody (NBP2-57815)

Discover more about diseases related to Mindin/Spondin-2 Antibody (NBP2-57815).
 

Pathways for Mindin/Spondin-2 Antibody (NBP2-57815)

View related products by pathway.

PTMs for Mindin/Spondin-2 Antibody (NBP2-57815)

Learn more about PTMs related to Mindin/Spondin-2 Antibody (NBP2-57815).

Blogs on Mindin/Spondin-2

There are no specific blogs for Mindin/Spondin-2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Mindin/Spondin-2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SPON2