Mindin/Spondin-2 Antibody

Images

 
Western Blot: Mindin/Spondin-2 Antibody [NBP2-30500] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate ...read more
Immunohistochemistry: Mindin/Spondin-2 Antibody [NBP2-30500] - Staining of human kidney shows strong cytoplasmic positivity in tubule cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Mindin/Spondin-2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: HPANSFYYPRLKALPPIARVTLLRLRQSPRAFIPPAPVLPSRDNEIVDSASVPETPLDCEVSLWSSWGLCGGHCGRLGTKSRTRYVRVQPANNGS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SPON2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Mindin/Spondin-2 Protein (NBP2-30500PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%), Rat (84%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Mindin/Spondin-2 Antibody

  • Differentially expressed in cancerous and non-cancerous lung cells 1
  • DIL1
  • DIL-1
  • DIL1FLJ34460
  • DKFZp686G21139
  • FLJ16313
  • FLJ22401
  • Mindin
  • M-SPONDIN
  • RG-1
  • SPON2
  • Spondin 2
  • spondin 2, extracellular matrix protein
  • spondin-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3135
Species: Hu
Applications: WB, Simple Western, Neut
NBP2-30536
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB500-179
Species: Hu, Mu, Rt, Po, Ma
Applications: WB, Simple Western, Flow, ICC/IF, IP
NBP1-31310
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB600-1468
Species: Hu
Applications: WB, IHC-P, S-ELISA
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF4036
Species: Hu
Applications: WB, Simple Western
NBP1-32920
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB140
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
H00005324-M02
Species: Hu
Applications: WB, ELISA, IHC
H00004830-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP2-22617
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP2-14040
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Mindin/Spondin-2 Antibody (NBP2-30500) (0)

There are no publications for Mindin/Spondin-2 Antibody (NBP2-30500).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Mindin/Spondin-2 Antibody (NBP2-30500) (0)

There are no reviews for Mindin/Spondin-2 Antibody (NBP2-30500). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Mindin/Spondin-2 Antibody (NBP2-30500) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Mindin/Spondin-2 Products

Bioinformatics Tool for Mindin/Spondin-2 Antibody (NBP2-30500)

Discover related pathways, diseases and genes to Mindin/Spondin-2 Antibody (NBP2-30500). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Mindin/Spondin-2 Antibody (NBP2-30500)

Discover more about diseases related to Mindin/Spondin-2 Antibody (NBP2-30500).
 

Pathways for Mindin/Spondin-2 Antibody (NBP2-30500)

View related products by pathway.

PTMs for Mindin/Spondin-2 Antibody (NBP2-30500)

Learn more about PTMs related to Mindin/Spondin-2 Antibody (NBP2-30500).

Blogs on Mindin/Spondin-2

There are no specific blogs for Mindin/Spondin-2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Mindin/Spondin-2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SPON2
Entrez
Uniprot