Mindin/Spondin-2 Antibody - BSA Free

Western Blot: Mindin/Spondin-2 Antibody [NBP2-30500] - Analysis in control (vector only transfected HEK293T lysate) and SPON2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: Mindin/Spondin-2 Antibody [NBP2-30500] - Staining of human placenta shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: Mindin/Spondin-2 Antibody [NBP2-30500] - Staining of human lymph node shows no positivity in non-germinal center cells as expected.

Immunohistochemistry-Paraffin: Mindin/Spondin-2 Antibody [NBP2-30500] - Staining of human pancreas shows low positivity in exocrine glandular cells as expected.

Immunohistochemistry-Paraffin: Mindin/Spondin-2 Antibody [NBP2-30500] - Staining of human prostate cancer shows strong cytoplasmic positivity in tumor cells.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Mindin/Spondin-2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: HPANSFYYPRLKALPPIARVTLLRLRQSPRAFIPPAPVLPSRDNEIVDSASVPETPLDCEVSLWSSWGLCGGHCGRLGTKSRTRYVRVQPANNGS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SPON2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Mindin/Spondin-2 Protein (NBP2-30500PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%), Rat (84%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Mindin/Spondin-2 Antibody - BSA Free

• Differentially expressed in cancerous and non-cancerous lung cells 1
• DIL1
• DIL-1
• DIL1FLJ34460
• DKFZp686G21139
• FLJ16313
• FLJ22401
• Mindin
• M-SPONDIN
• RG-1
• SPON2
• Spondin 2
• spondin 2, extracellular matrix protein
• spondin-2

Background

Cell adhesion protein that promotes adhesion and outgrowth of hippocampal embryonic neurons. Binds directly to bacteria and their components and functions as an opsonin for macrophage phagocytosis of bacteria. Essential in the initiation of the innate immune response and represents a unique pattern-recognition molecule in the ECM for microbial pathogens . Binds bacterial lipopolysaccharide (LPS)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SPON2
• Uniprot:
  • Q9BUD6()