Milk Fat Globule 1 membrane protein Antibody

Images

 
Western Blot: Milk Fat Globule 1 membrane protein Antibody [NBP1-90023] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: ...read more
Immunocytochemistry/ Immunofluorescence: Milk Fat Globule 1 membrane protein Antibody [NBP1-90023] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: Milk Fat Globule 1 membrane protein Antibody [NBP1-90023] - Staining of human placenta shows cytoplasmic positivity in trophoblastic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Milk Fat Globule 1 membrane protein Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LKNNSIPDKQITASSSYKTWGLHLFSWNPSYARLDKQGNFNAWVAGSYGNDQWLQVDLGSSKEVTGIITQGARNFGSVQFVASYKVAYSNDSANWTEYQDPRTGSSKIFPGNWDNHSHKKNLFETPILARYVRILPVAWHNRIALRLEL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MFGE8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Milk Fat Globule 1 membrane protein Protein (NBP1-90023PEP)
Publications
Read Publication using NBP1-90023.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Milk Fat Globule 1 membrane protein Antibody

  • BA46
  • Breast epithelial antigen BA46
  • EDIL1
  • hP47
  • HsT19888
  • lactadherin
  • medin
  • MFGE 8
  • MFG-E8HMFG
  • milk fat globule-EGF factor 8 protein
  • Milk fat globule-EGF factor 8
  • O-acetyl disialoganglioside synthase
  • OAcGD3S
  • SED1MFGM
  • SPAG10
  • sperm associated antigen 10
  • sperm surface protein hP47

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-22711
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-52414
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready, ICC, IF
NB600-935
Species: Bv
Applications: WB, ELISA, IP
NBP1-33320
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF591
Species: Mu
Applications: WB, Flow, CyTOF-ready
NB100-91761
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP2-33090
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NB600-713
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1219
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, CyTOF-ready, ICC
NBP2-15139
Species: Hu
Applications: WB, IHC, IHC-P
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-90023
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Milk Fat Globule 1 membrane protein Antibody (NBP1-90023)(1)

Reviews for Milk Fat Globule 1 membrane protein Antibody (NBP1-90023) (0)

There are no reviews for Milk Fat Globule 1 membrane protein Antibody (NBP1-90023). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Milk Fat Globule 1 membrane protein Antibody (NBP1-90023) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Milk Fat Globule 1 membrane protein Products

Bioinformatics Tool for Milk Fat Globule 1 membrane protein Antibody (NBP1-90023)

Discover related pathways, diseases and genes to Milk Fat Globule 1 membrane protein Antibody (NBP1-90023). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Milk Fat Globule 1 membrane protein Antibody (NBP1-90023)

Discover more about diseases related to Milk Fat Globule 1 membrane protein Antibody (NBP1-90023).
 

Pathways for Milk Fat Globule 1 membrane protein Antibody (NBP1-90023)

View related products by pathway.

PTMs for Milk Fat Globule 1 membrane protein Antibody (NBP1-90023)

Learn more about PTMs related to Milk Fat Globule 1 membrane protein Antibody (NBP1-90023).
 

Research Areas for Milk Fat Globule 1 membrane protein Antibody (NBP1-90023)

Find related products by research area.

Blogs on Milk Fat Globule 1 membrane protein

There are no specific blogs for Milk Fat Globule 1 membrane protein, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Milk Fat Globule 1 membrane protein Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MFGE8