MFG-E8 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: MFG-E8 Antibody [NBP1-90023] - Staining in human heart muscle and liver tissues.. Corresponding MFGE8 RNA-seq data are presented for the same tissues.
Orthogonal Strategies: Western Blot: MFG-E8 Antibody [NBP1-90023] - Analysis in human cell lines SK-MEL-30 and MCF-7 using anti-MFGE8 antibody. Corresponding MFGE8 RNA-seq data are presented for the same cell ...read more
Immunocytochemistry/ Immunofluorescence: MFG-E8 Antibody [NBP1-90023] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: MFG-E8 Antibody [NBP1-90023] - Staining of human tonsil shows moderate to strong cytoplasmic positivity in germinal center cells.
Immunohistochemistry-Paraffin: MFG-E8 Antibody [NBP1-90023] - Staining of human heart muscle shows moderate to strong cytoplasmic positivity in intercalated discs.
Immunohistochemistry-Paraffin: MFG-E8 Antibody [NBP1-90023] - Staining of human kidney shows moderate to strong cytoplasmic positivity in aortic media.
Immunohistochemistry-Paraffin: MFG-E8 Antibody [NBP1-90023] - Staining of human liver shows no positivity in hepatocytes as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

MFG-E8 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LKNNSIPDKQITASSSYKTWGLHLFSWNPSYARLDKQGNFNAWVAGSYGNDQWLQVDLGSSKEVTGIITQGARNFGSVQFVASYKVAYSNDSANWTEYQDPRTGSSKIFPGNWDNHSHKKNLFETPILARYVRILPVAWHNRIALRLEL
Specificity
Specificity of human MFG-E8 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MFGE8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04 - 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Milk Fat Globule 1 membrane protein Protein (NBP1-90023PEP)
Publications
Read Publication using NBP1-90023.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MFG-E8 Antibody

  • BA46
  • Breast epithelial antigen BA46
  • EDIL1
  • hP47
  • HsT19888
  • lactadherin
  • Lactahedrin
  • Medin
  • MFG1
  • MFGE8
  • MFG-E8
  • MFGM
  • milk fat globule-EGF factor 8 protein
  • Milk fat globule-EGF factor 8
  • O-acetyl disialoganglioside synthase
  • OAcGD3S
  • SED1
  • SPAG10
  • sperm associated antigen 10
  • sperm surface protein hP47

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-22711
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-75717
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-33320
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF591
Species: Mu
Applications: Flow, IHC, CyTOF-ready, Dual ISH-IHC
NB100-91761
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
NBP1-06579
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP2-67656
Species: Hu, Mu, Rt, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-67557
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF
NBP2-67731
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1445
Species: Mu, Rt
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-90023
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MFG-E8 Antibody (NBP1-90023)(1)

Reviews for MFG-E8 Antibody (NBP1-90023) (0)

There are no reviews for MFG-E8 Antibody (NBP1-90023). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MFG-E8 Antibody (NBP1-90023) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MFG-E8 Products

Bioinformatics Tool for MFG-E8 Antibody (NBP1-90023)

Discover related pathways, diseases and genes to MFG-E8 Antibody (NBP1-90023). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MFG-E8 Antibody (NBP1-90023)

Discover more about diseases related to MFG-E8 Antibody (NBP1-90023).
 

Pathways for MFG-E8 Antibody (NBP1-90023)

View related products by pathway.

PTMs for MFG-E8 Antibody (NBP1-90023)

Learn more about PTMs related to MFG-E8 Antibody (NBP1-90023).
 

Research Areas for MFG-E8 Antibody (NBP1-90023)

Find related products by research area.

Blogs on MFG-E8

There are no specific blogs for MFG-E8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MFG-E8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MFGE8